PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00022871-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family Dof
Protein Properties Length: 216aa    MW: 24071.9 Da    PI: 9.4482
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00022871-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.63.3e-392384263
                 zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                           ke+alkcprC+stntkfCyynnyslsqPryfCk+CrryWt+GG lrnvPvGg++rknk+sss
  SMil_00022871-RA_Salv 23 KEQALKCPRCKSTNTKFCYYNNYSLSQPRYFCKSCRRYWTEGGNLRNVPVGGSSRKNKRSSS 84
                           7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-241674IPR003851Zinc finger, Dof-type
PfamPF027015.8E-342581IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8072781IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102965IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MDSAQWLQGI GSRNSEKKPR PQKEQALKCP RCKSTNTKFC YYNNYSLSQP RYFCKSCRRY  60
WTEGGNLRNV PVGGSSRKNK RSSSSSISTH KSIPDLSCPP KHSPQNPKIH HGLHLNSSYN  120
DPPLCGTGIS DLFTQNPNLL ISAPVHNSNS AGFPMHELKP STDFSLENRF GNLEPAVQDN  180
PAILFPAVAD YEVEQLRGLQ RDSNGFWTGM LSGGSW
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022844511.16e-62dof zinc finger protein DOF4.6-like isoform X2
SwissprotQ8LAP85e-36DOF46_ARATH; Dof zinc finger protein DOF4.6
TrEMBLA0A4D9BQU51e-71A0A4D9BQU5_SALSN; Uncharacterized protein
STRINGVIT_16s0098g01420.t011e-59(Vitis vinifera)
STRINGPOPTR_0001s11130.11e-59(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.11e-32Dof family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]