PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00021489-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 288aa    MW: 32378.1 Da    PI: 7.0324
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00021489-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.84.3e-53181451128
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                            lppGfrFhPtdeel+v+yLkkk+++ +l++  +i+evd+yk++Pw+Lp+k++ +e+ewyfFs+r++ky++g+r+nra++sgyWkatg+
  SMil_00021489-RA_Salv  18 LPPGFRFHPTDEELLVHYLKKKAAAAPLPV-AIIAEVDLYKYDPWELPSKASFGEQEWYFFSPRERKYPNGERPNRAATSGYWKATGT 104
                            79****************************.88***************988899********************************** PP

                    NAM  89 dkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                            dk++l++ ++++ g+kk Lvfy g+ pkg+kt+W+mheyrl
  SMil_00021489-RA_Salv 105 DKPILTAnGTQKLGVKKALVFYGGKPPKGVKTNWIMHEYRL 145
                            *****9867778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-6314180IPR003441NAC domain
PROSITE profilePS5100561.51118179IPR003441NAC domain
PfamPF023651.2E-2719145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
LIDMEGTSSS GGNHQPRLPP GFRFHPTDEE LLVHYLKKKA AAAPLPVAII AEVDLYKYDP  60
WELPSKASFG EQEWYFFSPR ERKYPNGERP NRAATSGYWK ATGTDKPILT ANGTQKLGVK  120
KALVFYGGKP PKGVKTNWIM HEYRLVGDNS TANKPPGINL PKKSSSRLDD WVLCRIFKKN  180
SPTSSTEDYS RIPVVPEKAS DYSNFFDGNP MPAEETMFPA KEWQVHDDSL NPSSSSSDHH  240
RNISYISLLN QQYPQTIFHQ NSLVNSAGDD DDDAALHQSY QLPTSQFQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-721518117170NAC domain-containing protein 19
3swm_B1e-721518117170NAC domain-containing protein 19
3swm_C1e-721518117170NAC domain-containing protein 19
3swm_D1e-721518117170NAC domain-containing protein 19
3swp_A1e-721518117170NAC domain-containing protein 19
3swp_B1e-721518117170NAC domain-containing protein 19
3swp_C1e-721518117170NAC domain-containing protein 19
3swp_D1e-721518117170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family. May be associated with anther development and pollen production (Probable). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305|PubMed:21107887}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012848590.11e-119PREDICTED: NAC transcription factor 25
SwissprotQ8GY421e-100NAC25_ARATH; NAC transcription factor 25
TrEMBLA0A2G9HQE11e-115A0A2G9HQE1_9LAMI; Uncharacterized protein
STRINGMigut.M01170.1.p1e-118(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18142466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.12e-87NAC domain containing protein 25