PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00021275-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family Dof
Protein Properties Length: 191aa    MW: 21530.1 Da    PI: 9.5052
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00021275-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.21.5e-3758116260
                 zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                            +ek+++cprC s++tkfCy+nny+++qPr+fCk+C+ryWt GG++rnv vG+grrk k+
  SMil_00021275-RA_Salv  58 PEKIIPCPRCSSMDTKFCYFNNYNVNQPRHFCKQCQRYWTSGGTMRNVAVGSGRRKTKT 116
                            78999***************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027016.3E-3160116IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.23362116IPR003851Zinc finger, Dof-type
PROSITE patternPS01361064100IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-2364115IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MSAIKLFGKT ISPDHLFSDA SLSQQRHSSF ASSTSLDSKD ESSDYESSNG SEEKAKKPEK  60
IIPCPRCSSM DTKFCYFNNY NVNQPRHFCK QCQRYWTSGG TMRNVAVGSG RRKTKTALDH  120
TDFLFSFYCA SPPSLLGKHS RDEWRINNVS DAVGMFRESK APARIPLDDR ALLLRANPAA  180
FSRSLNFHER A
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Acts as a negative regulator in the phytochrome-mediated light responses. Controls phyB-mediated end-of-day response and the phyA-mediated anthocyanin accumulation. Not involved in direct flowering time regulation. {ECO:0000269|PubMed:19619493}.
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Regulates a photoperiodic flowering response. Transcriptional repressor of 'CONSTANS' expression. The stability of CDF2 is controlled by 'GIGANTEA' and redundantly by ADO3, ADO2 and/or ADO1. {ECO:0000250, ECO:0000269|PubMed:19619493}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By red or far-red light. Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}.
UniProtINDUCTION: Circadian-regulation. Highly expressed at the beginning of the light period, then decreases, reaching a minimum between 16 and 29 hours after dawn before rising again at the end of the day. Regulated at the protein level by ADO3 and GI pos-transcriptionally. {ECO:0000269|PubMed:19619493}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0218939e-33AC021893.18 Genomic Sequence for Oryza sativa, Nipponbare strain, clone OSJNBa0060A14, from chromosome 10, complete sequence.
GenBankAK0685889e-33AK068588.1 Oryza sativa Japonica Group cDNA clone:J013152P10, full insert sequence.
GenBankAP0149669e-33AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
GenBankCP0126189e-33CP012618.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 10 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012460726.15e-43PREDICTED: cyclic dof factor 1-like
SwissprotP683503e-37DOF15_ARATH; Dof zinc finger protein DOF1.5
SwissprotQ93ZL51e-35CDF2_ARATH; Cyclic dof factor 2
TrEMBLA0A4D8ZGF81e-65A0A4D8ZGF8_SALSN; Dof zinc finger protein DOF5.5
STRINGGorai.012G186900.12e-42(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.23e-31cycling DOF factor 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Bueso E, et al.
    Arabidopsis COGWHEEL1 links light perception and gibberellins with seed tolerance to deterioration.
    Plant J., 2016. 87(6): p. 583-96
    [PMID:27227784]