PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00020702-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 287aa    MW: 33048.9 Da    PI: 9.0884
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00020702-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.27.5e-54101351128
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                            lppGfrFhPtdeel+ +yL+++++++++++ ++i+evdiyk++Pw+Lp k++ +e+ewyfF++rd+ky++g r+nra+ sgyWkatg+
  SMil_00020702-RA_Salv  10 LPPGFRFHPTDEELIIYYLRNQATSRPCPV-SIIPEVDIYKFDPWQLPDKAEFGENEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGT 96 
                            79****************************.89***************99999*********************************** PP

                    NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            dk+++s +++ vg+kk Lvfykgr pkg+ktdW+mheyrl
  SMil_00020702-RA_Salv  97 DKAIHS-GSKYVGVKKALVFYKGRPPKGVKTDWIMHEYRL 135
                            ******.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-666162IPR003441NAC domain
PROSITE profilePS5100561.18710162IPR003441NAC domain
PfamPF023651.0E-2611135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009825Biological Processmultidimensional cell growth
GO:0009835Biological Processfruit ripening
GO:0009908Biological Processflower development
GO:0010150Biological Processleaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MVGSRISSGL PPGFRFHPTD EELIIYYLRN QATSRPCPVS IIPEVDIYKF DPWQLPDKAE  60
FGENEWYFFT PRDRKYPNGV RPNRAAVSGY WKATGTDKAI HSGSKYVGVK KALVFYKGRP  120
PKGVKTDWIM HEYRLNESRS QPYKQNGSMR LDDWVLCRIY KKKNLGRSSF EHQPIKVEES  180
FVSHQIAAAN DDRNRGSEEQ EAAAAAYRFP RTHSLTHLWE FDSYMGSSIS QLLNDNSSLY  240
NLNINNQEND NGGFLRAHEK LQQSSDSAAK SHVHQTTFVN PVYDQFQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-731016417167NO APICAL MERISTEM PROTEIN
1ut4_B5e-731016417167NO APICAL MERISTEM PROTEIN
1ut7_A5e-731016417167NO APICAL MERISTEM PROTEIN
1ut7_B5e-731016417167NO APICAL MERISTEM PROTEIN
3swm_A6e-731016420170NAC domain-containing protein 19
3swm_B6e-731016420170NAC domain-containing protein 19
3swm_C6e-731016420170NAC domain-containing protein 19
3swm_D6e-731016420170NAC domain-containing protein 19
3swp_A6e-731016420170NAC domain-containing protein 19
3swp_B6e-731016420170NAC domain-containing protein 19
3swp_C6e-731016420170NAC domain-containing protein 19
3swp_D6e-731016420170NAC domain-containing protein 19
4dul_A5e-731016417167NAC domain-containing protein 19
4dul_B5e-731016417167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence (developmental, light-induced and ABA-induced senescence) and regulates fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. Activates the expression of senescence and ABA associated genes including NCED1, ABCG40, CYP707A2, SAG113, SGR1 and PAO, by directly binding to their promoters. {ECO:0000269|PubMed:29760199}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00221DAPTransfer from AT1G69490Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. Induced by abscisic acid (ABA). {ECO:0000269|PubMed:29760199}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF7602080.0JF760208.1 Salvia miltiorrhiza NAC domain protein NAC2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011075519.11e-129LOW QUALITY PROTEIN: NAC transcription factor 29
SwissprotK4BNG71e-121NAP2_SOLLC; NAC domain-containing protein 2
TrEMBLG8E9N60.0G8E9N6_SALMI; NAC domain protein NAC2
STRINGPGSC0003DMT4000073411e-124(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74624103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-113NAC-like, activated by AP3/PI
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Ma X, et al.
    The NAC Transcription Factor SlNAP2 Regulates Leaf Senescence and Fruit Yield in Tomato.
    Plant Physiol., 2018. 177(3): p. 1286-1302
    [PMID:29760199]