PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00020369-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 169aa    MW: 18923.5 Da    PI: 10.1999
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00020369-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.99.6e-54151421128
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                            lppGfrFhPtdeel+v+yLkkk+++ +l++  +i+evd+yk++Pw+Lp+k++ +e+ewyfFs+r++ky++g+r+nra++sgyWkatg+
  SMil_00020369-RA_Salv  15 LPPGFRFHPTDEELLVHYLKKKAAAAPLPV-AIIAEVDLYKYDPWELPSKASFGEQEWYFFSPRERKYPNGERPNRAATSGYWKATGT 101
                            79****************************.88***************988899********************************** PP

                    NAM  89 dkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                            dk++l++ ++++ g+kk Lvfy g+ pkg+kt+W+mheyrl
  SMil_00020369-RA_Salv 102 DKPILTAnGTQKLGVKKALVFYGGKPPKGVKTNWIMHEYRL 142
                            *****9867778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.27E-5911148IPR003441NAC domain
PROSITE profilePS5100556.59615168IPR003441NAC domain
PfamPF023652.8E-2816142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MEGTSSSGGN HQPRLPPGFR FHPTDEELLV HYLKKKAAAA PLPVAIIAEV DLYKYDPWEL  60
PSKASFGEQE WYFFSPRERK YPNGERPNRA ATSGYWKATG TDKPILTANG TQKLGVKKAL  120
VFYGGKPPKG VKTNWIMHEY RLVGDNSTAN KPPGINLPKK SSSRVYNYI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-661214314143NO APICAL MERISTEM PROTEIN
1ut4_B7e-661214314143NO APICAL MERISTEM PROTEIN
1ut7_A7e-661214314143NO APICAL MERISTEM PROTEIN
1ut7_B7e-661214314143NO APICAL MERISTEM PROTEIN
3swm_A8e-661214317146NAC domain-containing protein 19
3swm_B8e-661214317146NAC domain-containing protein 19
3swm_C8e-661214317146NAC domain-containing protein 19
3swm_D8e-661214317146NAC domain-containing protein 19
3swp_A8e-661214317146NAC domain-containing protein 19
3swp_B8e-661214317146NAC domain-containing protein 19
3swp_C8e-661214317146NAC domain-containing protein 19
3swp_D8e-661214317146NAC domain-containing protein 19
4dul_A7e-661214314143NAC domain-containing protein 19
4dul_B7e-661214314143NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family. May be associated with anther development and pollen production (Probable). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305|PubMed:21107887}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096265.11e-105NAC transcription factor 25
SwissprotQ8GY426e-87NAC25_ARATH; NAC transcription factor 25
TrEMBLA0A2G9HQE13e-99A0A2G9HQE1_9LAMI; Uncharacterized protein
STRINGSolyc07g063420.2.13e-96(Solanum lycopersicum)
STRINGXP_009769986.14e-96(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18142466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.12e-77NAC domain containing protein 25