PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00020273-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 249aa    MW: 28847.1 Da    PI: 9.4321
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00020273-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM150.21e-46111382128
                    NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                             pGfrFhPt+eel+++yLk  v gkk++  +vi  ++iy+++P+dLpk +k++e+ewyfF++rd+k+  g r+nr+t++g+Wkatg+d
  SMil_00020273-RA_Salv  11 LPGFRFHPTEEELLNFYLKSMVFGKKFRG-DVIGFLNIYNYDPKDLPKLAKTGEREWYFFVPRDRKHGGGGRPNRTTAKGFWKATGSD 97 
                            59**************************9.99***************999999*********************************** PP

                    NAM  90 kevlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                            ++++     +++ glkktLvfy+grap+g+kt+W+m+eyrl
  SMil_00020273-RA_Salv  98 RQIMGGsdPKQTLGLKKTLVFYEGRAPRGRKTNWIMNEYRL 138
                            ****97667788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100551.86110156IPR003441NAC domain
SuperFamilySSF1019412.48E-5311156IPR003441NAC domain
PfamPF023653.2E-2512138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0010200Biological Processresponse to chitin
GO:0045792Biological Processnegative regulation of cell size
GO:0048281Biological Processinflorescence morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MDEESKYELK LPGFRFHPTE EELLNFYLKS MVFGKKFRGD VIGFLNIYNY DPKDLPKLAK  60
TGEREWYFFV PRDRKHGGGG RPNRTTAKGF WKATGSDRQI MGGSDPKQTL GLKKTLVFYE  120
GRAPRGRKTN WIMNEYRLPD YCSAPKDIVL CKIYMKATSL KVLEQRAAME EGAKTHASSS  180
LDSASLQFEG KELKREREER ESRPCSSLVL PNNIAELQVP KMSMDWMHDS FWTNLSPWLD  240
NFTPFMPMC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-4421566168Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011088680.11e-124NAC domain-containing protein 35
SwissprotQ10S651e-82NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBLA0A2G9I7J91e-122A0A2G9I7J9_9LAMI; Uncharacterized protein
STRINGMigut.B00028.1.p1e-122(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35312248
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.16e-97NAC domain containing protein 36
Publications ? help Back to Top
  1. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]