PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00020208-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family GRF
Protein Properties Length: 512aa    MW: 54843.6 Da    PI: 6.6987
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00020208-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.51.1e-23197240144
                    WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                            d+epgrC+RtDGKkWRCsr+v + +k+CErHlhrgr rsrk++e
  SMil_00020208-RA_Salv 197 DPEPGRCKRTDGKKWRCSRDVAPHQKYCERHLHRGRPRSRKPVE 240
                            79***************************************998 PP

2QLQ52.12.1e-18139171234
                    QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqa 34 
                            +FT aQ+ +L++Q+++yKy+++++PvPp+Ll++
  SMil_00020208-RA_Salv 139 PFTFAQWKELERQAMIYKYMISSVPVPPDLLFP 171
                            8*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.8E-10138174IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.9E-13139171IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.476139174IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.072197241IPR014977WRC domain
PfamPF088791.3E-19198240IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
LPFLGMSGLE KAAKQNRDSS ISQNKSSSGD DVVRLKRMMG SHPREINLFD RGGGRGVGGG  60
GGGGGGGPNS CNSGGATEAV GHAYGDDVSS SSRLGGENFA TSGTTNSQSF DIFAAAAYSA  120
TPYKSPEEMA AAAAAAAFPF TFAQWKELER QAMIYKYMIS SVPVPPDLLF PHSRNFSAAP  180
LDYPASLYNA RYSRNGDPEP GRCKRTDGKK WRCSRDVAPH QKYCERHLHR GRPRSRKPVE  240
VKNNAENLKK TRTEQSNVPS STTVSAQQFA AGNDKPLLLF NAKNDPTVSD APSSYKGPNR  300
DLSLMREGEM VVMDGTDQRW QHLIESNMGF VNVGSSSVYG SSSLYHQDYV EQQPLDVLSY  360
SNFSAPEIDA PTGFIDAWSI NNLDSSNSGN AESSVTTNHG NLSPSLNLSI AMAAGNIVDQ  420
EMGSLECCDE RHPRWINPLY WEPFARGGPL AEALQPGSVT ISGCDSISAP ATNVSSPTGV  480
LHRTLFSHSD GSVCSSPAPA APTSEIAFHR LN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15260GGRGVGGGG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011075906.10.0growth-regulating factor 2
TrEMBLA0A4D8ZDT70.0A0A4D8ZDT7_SALSN; Uncharacterized protein
STRINGMigut.F00160.1.p3e-96(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70322230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.12e-35growth-regulating factor 2