PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00019543-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 318aa    MW: 35909.2 Da    PI: 6.7987
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00019543-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM112.45e-35211461128
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                            l pG+rF Ptd el+  +L+ k+++    +  +i++v++y+++P+ L  +  + +++ewyfF++r++k+++g r+ r++  g+W+at 
  SMil_00019543-RA_Salv  21 LLPGYRFVPTDYELL-IHLHYKINHGVALT-PHIRDVRLYDSHPQALTeTYPAVGDNEWYFFTPRNRKHPKGFRPDRVAGGGFWRATA 106
                            579************.89****99988555.67**************8445556999******************************* PP

                    NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            + k+v++ +g+++g k+tLv+++g ++++ekt+W+mhey++
  SMil_00019543-RA_Salv 107 TVKKVKH-EGRVIGQKQTLVYHTGINKQSEKTSWMMHEYTA 146
                            *******.999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.58E-4417173IPR003441NAC domain
PROSITE profilePS5100542.31821173IPR003441NAC domain
PfamPF023653.4E-1923145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MMKECGSSSS SSSSSSIGDH LLPGYRFVPT DYELLIHLHY KINHGVALTP HIRDVRLYDS  60
HPQALTETYP AVGDNEWYFF TPRNRKHPKG FRPDRVAGGG FWRATATVKK VKHEGRVIGQ  120
KQTLVYHTGI NKQSEKTSWM MHEYTAHRDH PTAITRANRA TLDEWVLCRV YEKTTKVKGM  180
DRQEDVVETQ IHDQQFANSM IHAWGQINQQ DFPSHLLLPA QQFNNVNIGG DAAAAAAPNM  240
HEQDLFSLIN GSEAMQGTPM SPQDYVQRVD DHNISDVDVN AGAGVEQLCN GNNAVVQRNH  300
EDEMKEYMRM LGFPPIVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-352117517167NO APICAL MERISTEM PROTEIN
1ut4_B2e-352117517167NO APICAL MERISTEM PROTEIN
1ut7_A2e-352117517167NO APICAL MERISTEM PROTEIN
1ut7_B2e-352117517167NO APICAL MERISTEM PROTEIN
3swm_A2e-352117520170NAC domain-containing protein 19
3swm_B2e-352117520170NAC domain-containing protein 19
3swm_C2e-352117520170NAC domain-containing protein 19
3swm_D2e-352117520170NAC domain-containing protein 19
3swp_A2e-352117520170NAC domain-containing protein 19
3swp_B2e-352117520170NAC domain-containing protein 19
3swp_C2e-352117520170NAC domain-containing protein 19
3swp_D2e-352117520170NAC domain-containing protein 19
4dul_A2e-352117517167NAC domain-containing protein 19
4dul_B2e-352117517167NAC domain-containing protein 19
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8141386
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.22e-37NAC family protein