PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00018821-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family Dof
Protein Properties Length: 241aa    MW: 26254.1 Da    PI: 9.2199
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00018821-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof128.22.4e-402180463
                 zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                           +alkcprCds+ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk+sss
  SMil_00018821-RA_Salv 21 QALKCPRCDSANTKFCYYNNYSLSQPRYFCKSCRRYWTKGGTLRNVPVGGGCRKNKRSSS 80
                           789*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-28575IPR003851Zinc finger, Dof-type
PfamPF027014.2E-342177IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5342377IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102561IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MLGCNKSQQD QNKKPRPADM QALKCPRCDS ANTKFCYYNN YSLSQPRYFC KSCRRYWTKG  60
GTLRNVPVGG GCRKNKRSSS SSSSSSSSKR SHDPPPLPSP IPSMPPLSYN SNDLNLAIAR  120
LQKQNSAHLG GFLENQSAAN NGMHNLYYGN VEVDQNVGMA TSGPREMGMP SYDEYGGGTA  180
ATAVKQELCG GRDGDGRILW GFPWQNMSTG DGNGSDFDST RLNWNGIGSS NWQGLLNSPL  240
T
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3763883e-39AK376388.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3122H18.
GenBankAM0843603e-39AM084360.1 Hordeum vulgare subsp. vulgare dof12 gene for dof zinc finger protein 12, exons 1-2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089362.19e-93dof zinc finger protein DOF2.1
TrEMBLA0A4D9AWU81e-109A0A4D9AWU8_SALSN; Uncharacterized protein
STRINGXP_009622795.12e-74(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.13e-40TARGET OF MONOPTEROS 6