PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00018253-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family Dof
Protein Properties Length: 159aa    MW: 16820.3 Da    PI: 10.4296
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00018253-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.54e-4052110361
                 zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                             ++l+cprCds+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknk++
  SMil_00018253-RA_Salv  52 PENLRCPRCDSANTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKAT 110
                            57899***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.2E-3354109IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.41355109IPR003851Zinc finger, Dof-type
ProDomPD0074785.0E-2455105IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105793IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MIQELLGGSS VTIIGGDRSK LSTTTPCGGG GGGILDHASP SPSPPPSSAA APENLRCPRC  60
DSANTKFCYY NNYNLTQPRH FCKTCRRYWT KGGALRNVPI GGGCRKNKAT AIAAKSAAKL  120
RTPPPPQQQS EMALSPNSKP HDLGLPSKLP FPLPNPRKP
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:30626969}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cytokinin in procambium (PubMed:30626969). Induced by the transcription factor MONOPTEROS (MP) in cells relevant for root initiation, and later in vascular tissues and hypophysis (PubMed:20220754). {ECO:0000269|PubMed:20220754, ECO:0000269|PubMed:30626969}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM0843633e-57AM084363.1 Hordeum vulgare subsp. vulgare partial dof15 gene for dof zinc finger protein 15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020554970.13e-48dof zinc finger protein DOF1.1-like
SwissprotQ84TE94e-37DOF53_ARATH; Dof zinc finger protein DOF5.3
TrEMBLA0A4D9BVI95e-46A0A4D9BVI9_SALSN; Uncharacterized protein
STRINGSolyc02g090310.1.11e-43(Solanum lycopersicum)
STRINGPGSC0003DMT4000259842e-43(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.13e-33TARGET OF MONOPTEROS 6
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Miyashima S, et al.
    Mobile PEAR transcription factors integrate positional cues to prime cambial growth.
    Nature, 2019. 565(7740): p. 490-494
    [PMID:30626969]