PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00017965-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 279aa    MW: 32038.4 Da    PI: 6.7212
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00017965-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.86.8e-56221511129
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                            lppGfrFhPtdee++++yL +kv ++++ + ++i e+d++k+ePwdLpkk+k +ekew+fF++rd+ky+tg r+nrat+sgyWkatgk
  SMil_00017965-RA_Salv  22 LPPGFRFHPTDEEIIMHYLLHKVLDRRFVA-KAIGEADLNKCEPWDLPKKAKMGEKEWFFFCQRDRKYPTGMRTNRATESGYWKATGK 108
                            79*************************999.89***************99999*********************************** PP

                    NAM  89 dkevlsk..kgelvglkktLvfykgrapkgektdWvmheyrle 129
                            dke+++   ++ lvg+kktLvfykgrapkg kt+Wvmhe+rle
  SMil_00017965-RA_Salv 109 DKEIHRGtnSNCLVGMKKTLVFYKGRAPKGDKTNWVMHEFRLE 151
                            *****97444455***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.59E-6320176IPR003441NAC domain
PROSITE profilePS5100558.55822175IPR003441NAC domain
PfamPF023653.4E-2923150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MEVGFAGPSM SKEEDDELVV ELPPGFRFHP TDEEIIMHYL LHKVLDRRFV AKAIGEADLN  60
KCEPWDLPKK AKMGEKEWFF FCQRDRKYPT GMRTNRATES GYWKATGKDK EIHRGTNSNC  120
LVGMKKTLVF YKGRAPKGDK TNWVMHEFRL EGTFSTYNLS RPPKEEFVVC RVFHKNSGIR  180
RTPGVELSRL DPLVPMPPLT DYNDERVFWP QNALYLPKME HFSSVSQDTG LSTENVANHE  240
ITSKNMNMNT NAAAAFDDAE LQGLAFSPNI SDLDTLWSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-5271811171NO APICAL MERISTEM PROTEIN
1ut4_B8e-5271811171NO APICAL MERISTEM PROTEIN
1ut7_A8e-5271811171NO APICAL MERISTEM PROTEIN
1ut7_B8e-5271811171NO APICAL MERISTEM PROTEIN
4dul_A8e-5271811171NAC domain-containing protein 19
4dul_B8e-5271811171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00518DAPTransfer from AT5G18270Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011078584.11e-115NAC domain-containing protein 92
SwissprotQ9FK445e-92NAC87_ARATH; NAC domain-containing protein 87
TrEMBLR4NFR52e-96R4NFR5_JATCU; NAC transcription factor 003
STRINGXP_002525465.18e-97(Ricinus communis)
STRINGXP_010276452.11e-96(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.16e-94Arabidopsis NAC domain containing protein 87
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]