PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00017842-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 290aa    MW: 33303.4 Da    PI: 4.8413
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00017842-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.73.1e-55311581128
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                            lppGfrFhPtdeelv++yLk+k++g+++el ++i+evd+yk+ePw+L  k  + +++ ewyfF +rd+ky++g r+nrat++gyWk+t
  SMil_00017842-RA_Salv  31 LPPGFRFHPTDEELVNYYLKRKIQGQEIEL-DIIPEVDLYKCEPWELAdKsFLPSRDPEWYFFGPRDRKYPNGFRTNRATRAGYWKST 117
                            79****************************.99**************85335566888****************************** PP

                    NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            gkd++v+s ++++vg+kktLv+y+grap+g +tdWvmheyrl
  SMil_00017842-RA_Salv 118 GKDRRVTS-QNRAVGMKKTLVYYRGRAPQGIRTDWVMHEYRL 158
                            ********.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.26E-6125203IPR003441NAC domain
PROSITE profilePS5100559.06331203IPR003441NAC domain
PfamPF023653.0E-3032158IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MELYKSHMMV VLLEHFKSGA GGGIIMAPVG LPPGFRFHPT DEELVNYYLK RKIQGQEIEL  60
DIIPEVDLYK CEPWELADKS FLPSRDPEWY FFGPRDRKYP NGFRTNRATR AGYWKSTGKD  120
RRVTSQNRAV GMKKTLVYYR GRAPQGIRTD WVMHEYRLDD KEWEDVSGIQ VLDLLSDKVS  180
SFTLSFNNNE TKDSYALCRV FKKNGLCSEV EELGQSSSIP LLDHYMQGAS NEHETMSPDF  240
PLASSSTICM EEEDKDDKDE SWMQFITDDV WCSSSATFGG EEVSHMGFTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-532715811140Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00363DAPTransfer from AT3G17730Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020548077.11e-152NAC domain-containing protein 86 isoform X1
SwissprotQ9FFI58e-83NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A3N7FT431e-143A0A3N7FT43_POPTR; Uncharacterized protein
STRINGMigut.O00243.1.p1e-150(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46212442
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-117NAC domain containing protein 57
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]