PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00017796-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 238aa    MW: 27366 Da    PI: 9.685
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00017796-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.82e-53101351128
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                            lppGfrFhPtdeel+++yLk++++++++++ ++i+evdiyk++Pw+Lp+k+  +e+ewyfFs+rd+ky++g r+nra+ sgyWkatg+
  SMil_00017796-RA_Salv  10 LPPGFRFHPTDEELIMFYLKNQATSRTCPV-SIIPEVDIYKFDPWELPEKAGFGESEWYFFSPRDRKYPNGVRPNRAAVSGYWKATGT 96 
                            79****************************.89***************9999999********************************* PP

                    NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            dk ++s +++ vg+kk Lvfykg+ pkg+ktdW+mheyrl
  SMil_00017796-RA_Salv  97 DKVIYS-RSKFVGVKKALVFYKGKPPKGVKTDWIMHEYRL 135
                            ******.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-606141IPR003441NAC domain
PROSITE profilePS5100554.61510157IPR003441NAC domain
PfamPF023651.8E-2611135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MVGAYSSTDL PPGFRFHPTD EELIMFYLKN QATSRTCPVS IIPEVDIYKF DPWELPEKAG  60
FGESEWYFFS PRDRKYPNGV RPNRAAVSGY WKATGTDKVI YSRSKFVGVK KALVFYKGKP  120
PKGVKTDWIM HEYRLGESRP HPSKQNGSMR MHKFPRTCSL THLWEYEYMT SITQLLDENA  180
YNAPFNNQEG YSKMGAKSTS QGKFSYLHRR HETPSPSIDF CESSVSTAVN KNNIGLRN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A6e-64615116157NAC domain-containing protein 19
3swm_B6e-64615116157NAC domain-containing protein 19
3swm_C6e-64615116157NAC domain-containing protein 19
3swm_D6e-64615116157NAC domain-containing protein 19
3swp_A6e-64615116157NAC domain-containing protein 19
3swp_B6e-64615116157NAC domain-containing protein 19
3swp_C6e-64615116157NAC domain-containing protein 19
3swp_D6e-64615116157NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence (developmental, light-induced and ABA-induced senescence) and regulates fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. Activates the expression of senescence and ABA associated genes including NCED1, ABCG40, CYP707A2, SAG113, SGR1 and PAO, by directly binding to their promoters. {ECO:0000269|PubMed:29760199}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. Induced by abscisic acid (ABA). {ECO:0000269|PubMed:29760199}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028086269.11e-103NAC domain-containing protein 2-like
SwissprotK4BNG78e-97NAP2_SOLLC; NAC domain-containing protein 2
TrEMBLA0A2G9FYW31e-107A0A2G9FYW3_9LAMI; Uncharacterized protein
STRINGEOY018691e-102(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74624103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.16e-87NAC-like, activated by AP3/PI
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Ma X, et al.
    The NAC Transcription Factor SlNAP2 Regulates Leaf Senescence and Fruit Yield in Tomato.
    Plant Physiol., 2018. 177(3): p. 1286-1302
    [PMID:29760199]