PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00017347-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 466aa    MW: 51304.8 Da    PI: 10.3795
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00017347-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM100.52.3e-3121328654128
                    NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk +++ +g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  SMil_00017347-RA_Salv 213 GEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITT-EGRKVGIKKALVFYVGKAPKGTKTNWIMHEYRL 286
                            689**********************************9999.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100536.395156309IPR003441NAC domain
PfamPF023653.2E-15199286IPR003441NAC domain
SuperFamilySSF1019412.75E-42207309IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MEKSFCSSFS TTALVRRPPR TASPPTSLIT PTPPSSPANH ERRDLDFRRR ATLPPLLLRN  60
CGSGYLEIWR SVAVVMVEVR RRDNFSSAIP LPSVKRRPPP PGSTQRGLVS NCRVPPPPFT  120
NATDHRALHL QFTANSAKPP NPKPQPPLSL SQRSLFPSHS PSHFPSLDSC NSGARSEEVA  180
EGSRSIAIEL GFVVAPEKPK RRGFGILGKA LFGEKEWYFF SPRDRKYPNG SRPNRVAGSG  240
YWKATGTDKI ITTEGRKVGI KKALVFYVGK APKGTKTNWI MHEYRLSESS RKNGSSKLDD  300
WVLCRIYKKN SSGQDRSAAL AGGVVQSKEY SHDSSSSCSS QYDDVLDSLP ELDDRYFSMD  360
SLKNSQLQDD QKLNLQRLSS GNFDWATLAG LGPLWPELLQ AQQTSAPPAS QNDTLAPANF  420
MDGNQRVSNS GLLPQHLTGL TQGMPGSVDA FSLRYPNQSG GFGFRQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A7e-6520931468173NAC domain-containing protein 19
3swm_B7e-6520931468173NAC domain-containing protein 19
3swm_C7e-6520931468173NAC domain-containing protein 19
3swm_D7e-6520931468173NAC domain-containing protein 19
3swp_A7e-6520931468173NAC domain-containing protein 19
3swp_B7e-6520931468173NAC domain-containing protein 19
3swp_C7e-6520931468173NAC domain-containing protein 19
3swp_D7e-6520931468173NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in abscisic acid-mediated stomatal closure (PubMed:25005917). Regulates the expression of NCED1, a gene involved in the biosynthesis of abscisic acid (ABA) (PubMed:25005917). Required for the stomatal closure induced by the bacterial pathogen Pseudomonas syringae pv tomato DC3000, but not for stomatal reopening (PubMed:25005917). {ECO:0000269|PubMed:25005917}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA), dehydration and wounding. {ECO:0000269|PubMed:25005917}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095243.11e-106NAC domain-containing protein 72
SwissprotQ9SQL04e-91JA2_SOLLC; NAC domain-containing protein JA2
TrEMBLA0A4D8YKK01e-127A0A4D8YKK0_SALSN; Uncharacterized protein
STRINGMigut.M00863.1.p1e-104(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31222452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.34e-79NAC family protein
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]