PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00017329-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family CO-like
Protein Properties Length: 393aa    MW: 43061.3 Da    PI: 8.0311
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00017329-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box26.61.3e-0874119342
               zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                             ++C+ +e+ ++   C+ +   lC +C   +H        H++vp+
  SMil_00017329-RA_Salv  74 VWMCEVCEQAPAVVTCKADAAALCVTCDRDIHAAnplasrHERVPV 119
                            689*****************************66899999999986 PP

2CCT70.63.8e-24321364144
                    CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                            Rea++lRYkeKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  SMil_00017329-RA_Salv 321 REARVLRYKEKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 364
                            9*****************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003363.0E-1572119IPR000315B-box-type zinc finger
PROSITE profilePS5011910.70872119IPR000315B-box-type zinc finger
PfamPF006432.5E-674119IPR000315B-box-type zinc finger
CDDcd000214.32E-1075119No hitNo description
PfamPF062034.1E-18321363IPR010402CCT domain
PROSITE profilePS5101716.638321363IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
LFDCHTKYGD DTRRRWRPQQ AKVLSGRAEC GGEALRLLQV RGCASLLPRG IGFHVHSLRL  60
QGHNAADSHK HERVWMCEVC EQAPAVVTCK ADAAALCVTC DRDIHAANPL ASRHERVPVV  120
PFYDTAESVV IKSAAAAATL LSPAAESDAS LFAGVGHDRK FDPDGGYIPD SSWMPTSPIV  180
AAKIPGDAPD LKAMELFFQD SDQFLDFDNY QISSQPYSDS VVPVQTTVKP PFPARFTHDH  240
SPENQFEIDF TRSNFNSTTT TTTAASRHRL SATVSSSSMD VGVVPDGSSL SEISYPFGRN  300
IGGSTADPTG NQGSLAVGMD REARVLRYKE KRKNRKFEKT IRYASRKAYA ETRPRIKGRF  360
AKRTDSESDI DRIFGVGAAN FIADARFGIV PSF
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4319124e-43AM431912.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X066689.12, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011069877.11e-168zinc finger protein CONSTANS-LIKE 5-like
TrEMBLA0A2G9HFV01e-165A0A2G9HFV0_9LAMI; GATA-4/5/6 transcription factor
STRINGMigut.K00262.1.p1e-118(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.18e-62CONSTANS-like 4