PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00016654-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family Dof
Protein Properties Length: 283aa    MW: 30691.3 Da    PI: 8.4788
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00016654-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.62.7e-383088361
                 zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                           e+al+cprCds ntkfCyynnysl+qPr+fCk+CrryWtkGGalr vP+Ggg+rknkk+
  SMil_00016654-RA_Salv 30 EAALRCPRCDSPNTKFCYYNNYSLTQPRHFCKTCRRYWTKGGALRSVPIGGGCRKNKKT 88
                           67899****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-263287IPR003851Zinc finger, Dof-type
PfamPF027011.4E-323287IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.053387IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103571IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MSPDNSRAAA GRDETPSSTC RKSAAARPQE AALRCPRCDS PNTKFCYYNN YSLTQPRHFC  60
KTCRRYWTKG GALRSVPIGG GCRKNKKTRP SPPLSADSSS DIAGGLKFFQ GVAPAMDFQL  120
NFPGTTTSLL NHFSALGDSS ANPCYTLDLS ATPNPPLIGF DLSPPNQELG FRSSLASSME  180
SLSSINQDLH WKLQKQRLAM LLPADNHKTV KPQPILFQDL ELPSKQDACV RKDDGAAVAT  240
EWFFDTSYNA TAATSNGVNA DNGTGWSTGI QAWSDLSHYS SIP
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP6629112e-41KP662911.1 Cajanus cajan Dof7 (Dof7) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011097460.11e-100dof zinc finger protein DOF5.7-like
TrEMBLA0A4D8ZW161e-131A0A4D8ZW16_SALSN; Uncharacterized protein
TrEMBLA0A4D9BV831e-131A0A4D9BV83_SALSN; Uncharacterized protein
STRINGEOX918923e-97(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52422234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.16e-60Dof family protein