PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00016549-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family ARF
Protein Properties Length: 658aa    MW: 73689.9 Da    PI: 7.3336
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00016549-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.31.2e-22127226197
                            EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEE CS
                     B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFk 83 
                            f+k+lt sd++++g +++ +k+a+e+     + +++ +++l  +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF 
  SMil_00016549-RA_Salv 127 FCKILTASDTSTHGGFSVLRKHANEClppldMTQPTPTQDLAAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDCFVFL 214
                            99****************************9666667789************************************************ PP

                            E-SSSEE..EEEEE CS
                     B3  84 ldgrsefelvvkvf 97 
                              + +++el+v+++
  SMil_00016549-RA_Salv 215 --RGDNGELRVGIR 226
                            ..3489999**997 PP

2Auxin_resp1011.6e-33253332183
             Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                            a+ha++t++ F v+Y+Pr+  s+F++ ++k+++a+k+ +svGmRfkm+fe+eds+err++Gt+vg  d+++ +W++S WrsLk
  SMil_00016549-RA_Salv 253 ASHAITTQTLFVVYYKPRT--SQFIIGLNKYLEAMKHGFSVGMRFKMRFEGEDSPERRFTGTIVGFGDFSS-QWTKSAWRSLK 332
                            789***************6..9**********************************************888.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019369.55E-39119256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.1E-38121242IPR015300DNA-binding pseudobarrel domain
CDDcd100171.28E-19126226No hitNo description
PROSITE profilePS5086311.547127229IPR003340B3 DNA binding domain
SMARTSM010192.3E-19127229IPR003340B3 DNA binding domain
PfamPF023621.6E-20127226IPR003340B3 DNA binding domain
PfamPF065071.1E-31253332IPR010525Auxin response factor
PfamPF023099.7E-7524579IPR033389AUX/IAA domain
SuperFamilySSF542776.38E-16536619No hitNo description
Gene3DG3DSA:3.10.20.2403.7E-4542617No hitNo description
PROSITE profilePS5174527.911543635IPR000270PB1 domain
PfamPF023093.2E-8589633IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 658 aa     Download sequence    Send to blast
MAHADGLIRG GSHERGVGSN DLYTELWKAC AGPLVDVPCV RERVYYFPQG HMEQLEASTN  60
QELNQQIPHF NLPPKILCRV VHIQLKAEPE TDEVYAQITL QPEPDQSEPT SPDPSPPDLP  120
KPAVQSFCKI LTASDTSTHG GFSVLRKHAN ECLPPLDMTQ PTPTQDLAAK DLHGYEWRFK  180
HIFRGQPRRH LLTTGWSTFV TSKRLVAGDC FVFLRGDNGE LRVGIRHLAR HQSSMPPSVI  240
SSQSMHLGVL ATASHAITTQ TLFVVYYKPR TSQFIIGLNK YLEAMKHGFS VGMRFKMRFE  300
GEDSPERRFT GTIVGFGDFS SQWTKSAWRS LKVQWDEPAT IMRPDRVSPW EIEPFVASAS  360
VDASLPAMKM KRPRPLDLPL TETITASAAS PIWYPKSTTS LELSHLTSTN DVQSSDKQFS  420
GLLNRKSTIS QVLHHILVEH GRLYRMTSNC LDHIKKSETA PACRLFGFDL RNNVNKLPHP  480
LEKEAPLARP STILGCDSLP KRPETDEKKG VDVLASSKER KDAQVEAPPN DTQGQQGFVL  540
SSRTRIKVQM QGIAVGRGVD LSAFHGYDDL IEEMESMFDI KGELRARNKW EVVYTDNEGD  600
MMLVGDDPWQ EFCKMAKKIC IYSSDEVKKM SPRCKLPISP IDGEATVLSS ESQPKSEA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1711635513355Auxin response factor 1
4ldw_A1e-1711635513355Auxin response factor 1
4ldw_B1e-1711635513355Auxin response factor 1
4ldx_A1e-1711635513355Auxin response factor 1
4ldx_B1e-1711635513355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1370374KRPRP
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKX0367381e-170KX036738.1 Salvia miltiorrhiza auxin response factor ARF18 (ARF) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011093958.10.0auxin response factor 18 isoform X2
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLA0A191T8U00.0A0A191T8U0_SALMI; Auxin response factor
STRINGXP_009797447.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61830.10.0auxin response factor 18
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]