PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00015998-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family LFY
Protein Properties Length: 387aa    MW: 43441.8 Da    PI: 6.2036
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00015998-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY618.31.4e-18813721386
                FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeeldd 88 
                            mdp+afsaslfkwdpra   app+rlle  + +++p+ aa ++  r+l +leelf+ayG+ry+t+akiaelGftv+tL+dm+deeld+
  SMil_00015998-RA_Salv   1 MDPDAFSASLFKWDPRAGL-APPNRLLEAVVPPPPPAPAAYSMRPRELGGLEELFQAYGIRYFTAAKIAELGFTVNTLLDMRDEELDE 87 
                            9**************9877.67889998888888888888888889999*************************************** PP

                FLO_LFY  89 lmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqeekeaagsggeglgeaelvaa 176
                            +m+sl++ifr+dllvGeryGikaavraerrrl+ee+  ++rr+lls d ++aldalsqeglseepvq+ekeaagsgg+g   +e+v+a
  SMil_00015998-RA_Salv  88 MMNSLCQIFRWDLLVGERYGIKAAVRAERRRLDEED--ARRRHLLSGDASHALDALSQEGLSEEPVQQEKEAAGSGGGG--VWEMVVA 171
                            **********************************88..99999********************************9999..9999999 PP

                FLO_LFY 177 eekkseeekkkaskkkqkrkkkkelkseededeeeeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLl 264
                            + +k+ ++k++    k  r ++ ++++e+d+d+e+e  ed+e+ g +g+erqrehPfivtepgevargkknGLDYLf+LyeqCrefL+
  SMil_00015998-RA_Salv 172 NGRKQRRRKSSC---KG-RSRMASMEEEDDDDDETEGAEDDENCGGGGNERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCREFLI 255
                            865433333222...33.33334445566777777778888999999***************************************** PP

                FLO_LFY 265 qvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqg 352
                            qvq+iakerGekcPtk         +++ga+yinkPkmrhYvhCYalhcLdee+snalrrafkergenvGawrqacykplva+aarqg
  SMil_00015998-RA_Salv 256 QVQNIAKERGEKCPTKCSG-----TRRSGANYINKPKMRHYVHCYALHCLDEETSNALRRAFKERGENVGAWRQACYKPLVAVAARQG 338
                            ****************987.....589************************************************************* PP

                FLO_LFY 353 wdidavfnahprLsiWYvPtkLrqLChlerskas 386
                            wdida+fnahprLsiWYvPtkLrqLCh+ers+++
  SMil_00015998-RA_Salv 339 WDIDAIFNAHPRLSIWYVPTKLRQLCHAERSTTA 372
                            ******************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016987.3E-1971371IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MDPDAFSASL FKWDPRAGLA PPNRLLEAVV PPPPPAPAAY SMRPRELGGL EELFQAYGIR  60
YFTAAKIAEL GFTVNTLLDM RDEELDEMMN SLCQIFRWDL LVGERYGIKA AVRAERRRLD  120
EEDARRRHLL SGDASHALDA LSQEGLSEEP VQQEKEAAGS GGGGVWEMVV ANGRKQRRRK  180
SSCKGRSRMA SMEEEDDDDD ETEGAEDDEN CGGGGNERQR EHPFIVTEPG EVARGKKNGL  240
DYLFHLYEQC REFLIQVQNI AKERGEKCPT KCSGTRRSGA NYINKPKMRH YVHCYALHCL  300
DEETSNALRR AFKERGENVG AWRQACYKPL VAVAARQGWD IDAIFNAHPR LSIWYVPTKL  360
RQLCHAERST TAASSSITAA GVDHLPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy2_A1e-1002153832175PROTEIN LEAFY
2vy1_A1e-1002153832175PROTEIN LEAFY
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1175180QRRRKS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011073600.10.0PREDICTED: LOW QUALITY PROTEIN: floricaula protein
SwissprotP239150.0FLO_ANTMA; Floricaula protein
TrEMBLA5A4R20.0A5A4R2_PLESU; Floricaula
STRINGVIT_17s0000g00150.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA66682333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-141floral meristem identity control protein LEAFY (LFY)