PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00015070-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family Dof
Protein Properties Length: 253aa    MW: 27631.6 Da    PI: 8.9912
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00015070-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.81.3e-393899263
                 zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                           ke+al+cprC+stntkfCyynnyslsqPryfCk+CrryWt+GG+lrn+PvGgg+rkn++sss
  SMil_00015070-RA_Salv 38 KEQALNCPRCNSTNTKFCYYNNYSLSQPRYFCKTCRRYWTEGGSLRNIPVGGGSRKNRRSSS 99
                           7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-263190IPR003851Zinc finger, Dof-type
PfamPF027011.9E-334096IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1344296IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104480IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MDTAAAQWPP QVKQMEEILN CPKRSGSGSS ERKMRPQKEQ ALNCPRCNST NTKFCYYNNY  60
SLSQPRYFCK TCRRYWTEGG SLRNIPVGGG SRKNRRSSSS SPISTSTKRL PDLVPPQNPN  120
HHHDFKALSD MIHLSSPPPP QLSSLELLTG LASTSRGLSS FMPSPPDPYS SSGPGFPMAE  180
FKPSSLNFSL DGLGTGGGAG YGNFQGVPET NGKLLFPFED LKQQVSSNNA DQNRDDNDNS  240
NGYWNGVIGG GSW
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022736728.13e-90dof zinc finger protein DOF4.6-like
SwissprotQ8LAP82e-50DOF46_ARATH; Dof zinc finger protein DOF4.6
TrEMBLA0A4D8Z9L11e-101A0A4D8Z9L1_SALSN; Uncharacterized protein
STRINGPOPTR_0001s11130.13e-88(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.19e-38Dof family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]