PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00014556-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 171aa    MW: 19811.3 Da    PI: 9.6579
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00014556-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM110.42e-342610053128
                    NAM  53 aeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            +++ ewyfFs+rd+ky++g+r+nratk+gyWkatgkd++v s ++++vg+kktLv+y+grap+g +tdWvmheyrl
  SMil_00014556-RA_Salv  26 SKDLEWYFFSPRDRKYPNGSRTNRATKAGYWKATGKDRKVNS-QTRAVGMKKTLVYYRGRAPHGARTDWVMHEYRL 100
                            4667**************************************.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100538.7531124IPR003441NAC domain
SuperFamilySSF1019418.5E-4025124IPR003441NAC domain
PfamPF023659.3E-1825100IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MCYGTLEYAW IANIRRILQG KSLLPSKDLE WYFFSPRDRK YPNGSRTNRA TKAGYWKATG  60
KDRKVNSQTR AVGMKKTLVY YRGRAPHGAR TDWVMHEYRL DDRECDTPSS GLQDAYALCR  120
VFKKSLNIPK VGENYVTHPS STPNYEDPPD PSWPHYLSEE AFAFTNNPYQ A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-352312461165NO APICAL MERISTEM PROTEIN
1ut4_B9e-352312461165NO APICAL MERISTEM PROTEIN
1ut7_A9e-352312461165NO APICAL MERISTEM PROTEIN
1ut7_B9e-352312461165NO APICAL MERISTEM PROTEIN
3swm_A9e-352312564169NAC domain-containing protein 19
3swm_B9e-352312564169NAC domain-containing protein 19
3swm_C9e-352312564169NAC domain-containing protein 19
3swm_D9e-352312564169NAC domain-containing protein 19
3swp_A9e-352312564169NAC domain-containing protein 19
3swp_B9e-352312564169NAC domain-containing protein 19
3swp_C9e-352312564169NAC domain-containing protein 19
3swp_D9e-352312564169NAC domain-containing protein 19
4dul_A9e-352312461165NAC domain-containing protein 19
4dul_B9e-352312461165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC086, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Regulated by the transcription factor APL (AC Q9SAK5). {ECO:0000269|PubMed:25081480}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012835579.14e-79PREDICTED: NAC domain-containing protein 86
SwissprotA4VCM02e-57NAC45_ARATH; NAC domain-containing protein 45
TrEMBLA0A022RF035e-79A0A022RF03_ERYGU; Uncharacterized protein (Fragment)
STRINGMigut.K00745.1.p2e-78(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA3070522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-63NAC domain containing protein 28
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]