PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00014491-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family Dof
Protein Properties Length: 225aa    MW: 23601.4 Da    PI: 8.6018
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00014491-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.28.6e-392484262
                 zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                           + ++l+cprCdstntkfCyynny+ sqPr+fCkaCrryWt+GG+lr++PvGgg+rkn k+s
  SMil_00014491-RA_Salv 24 EPEHLPCPRCDSTNTKFCYYNNYNFSQPRHFCKACRRYWTHGGTLRDIPVGGGSRKNAKRS 84
                           568899***************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.0E-332782IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2082882IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103066IPR003851Zinc finger, Dof-type
ProDomPD0074784.0E-243282IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0009751Biological Processresponse to salicylic acid
GO:0042545Biological Processcell wall modification
GO:0045787Biological Processpositive regulation of cell cycle
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MATDTSEKKA TKSGQAGAAP PPQEPEHLPC PRCDSTNTKF CYYNNYNFSQ PRHFCKACRR  60
YWTHGGTLRD IPVGGGSRKN AKRSRTSHIP APVPANAIFS AAYHRDFRHL PAAASQLLVP  120
LGANHSGDTP FVSDGKMGGS FTTLLNSSPA TGLLALGGFG VGLEEVGFGL GRAAWPFAAV  180
VDSAGPGSAG PGHTWQLESG ETGFVAGDCF GFPDLAISTP GSFFK
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00402DAPTransfer from AT3G50410Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin and salicylic acid (SA). {ECO:0000269|PubMed:10758484}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP6629223e-85KP662922.1 Cajanus cajan Dof38 (Dof38) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099306.12e-98dof zinc finger protein DOF3.4
SwissprotQ390881e-54DOF34_ARATH; Dof zinc finger protein DOF3.4
TrEMBLA0A4D9C1414e-99A0A4D9C141_SALSN; Uncharacterized protein
STRINGMigut.H00486.1.p5e-87(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45322241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50410.19e-46OBF binding protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]