PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00014480-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family Dof
Protein Properties Length: 242aa    MW: 26155.1 Da    PI: 8.9568
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00014480-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof114.74e-364298359
                 zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
                            +alkcprC stntkfCyynny+ sqPr+fCk+C+r+WtkGG+lrnvPvGggr++++
  SMil_00014480-RA_Salv 42 AEALKCPRCASTNTKFCYYNNYNKSQPRHFCKSCKRHWTKGGTLRNVPVGGGRKNKR 98
                           6789***********************************************977665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-233898IPR003851Zinc finger, Dof-type
PfamPF027011.5E-314497IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.3914599IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104783IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MGLSTKQVSG DQGVDWGQTF LQSAAAAETP KAPATRRLQA QAEALKCPRC ASTNTKFCYY  60
NNYNKSQPRH FCKSCKRHWT KGGTLRNVPV GGGRKNKRPK ISKSAATAPA GQKNMSNILY  120
HALIGRSSSP LVHETTTSKG VDNITSPFTG ANAAPTTEFQ LSSLGTFDMN ASLNPSSYQP  180
LNAFDHFSGN LDSVEESSIT TVNIPGSSGG AWDLPNYWSW NDIDVLTSGD LSMSWDDQDK  240
PL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096259.12e-99PREDICTED: dof zinc finger protein DOF1.4-like
TrEMBLA0A022QJ281e-67A0A022QJ28_ERYGU; Uncharacterized protein
STRINGPOPTR_0004s03900.11e-62(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61712033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.15e-30OBF binding protein 4