PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00014298-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 358aa    MW: 41748.9 Da    PI: 10.5091
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00014298-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.44.8e-52451691128
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                            lppGfrFhPtdeelv++yL +k++++++ +  +i+e+d+yk++Pw+Lp     +ekewyfFs+rd+ky++g+r+nra+ sgyWkatg 
  SMil_00014298-RA_Salv  45 LPPGFRFHPTDEELVMHYLIRKCASQSIAV-PIIAEIDLYKYDPWELPGLSLYGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGA 131
                            79*************************999.88***************64455799******************************** PP

                    NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            dk++ +   + vg+kk Lvfy+g+ap+gekt+W+mheyrl
  SMil_00014298-RA_Salv 132 DKPIGQ--PKSVGIKKALVFYSGKAPRGEKTNWIMHEYRL 169
                            ****98..678***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-6237196IPR003441NAC domain
PROSITE profilePS5100560.73745196IPR003441NAC domain
PfamPF023659.2E-2846169IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
LLSPKFHTHI CNLYLYYIHR EREGDFLYIK SFKFLREMAA VNLQLPPGFR FHPTDEELVM  60
HYLIRKCASQ SIAVPIIAEI DLYKYDPWEL PGLSLYGEKE WYFFSPRDRK YPNGSRPNRA  120
AGSGYWKATG ADKPIGQPKS VGIKKALVFY SGKAPRGEKT NWIMHEYRLA DVDRSARKKN  180
NSLRLDDWVL CRIYNKKGTI ERRQQQQQQQ QQASVSSRNM TSAVTTEEDT KPVILTSVPE  240
SSAMVYDDFM YLTRRIRCRG CTRTRAARST CCRRRWRARR SWRSGRGRRW ISPSGTWTAG  300
ERAARCSRGI IRWSRCRRCC AVHEQAVLRA REFWSHVAQE TRVYECARAT APGLVSVL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-78392029174Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011069419.11e-134NAC domain-containing protein 2
TrEMBLA0A2G9HHN71e-134A0A2G9HHN7_9LAMI; Uncharacterized protein
STRINGMigut.C01110.1.p1e-132(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12392481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-111NAC family protein