PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00013747-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 417aa    MW: 48014.2 Da    PI: 4.8847
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00013747-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM147.66.3e-46321582128
                    NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                            +pGfrF+Ptd el+veyL+kk++++++++ + ++e+++ +v+Pwd+++   k+ + e+ewyfF++rd+ky++g+r+ r  +sgyWkat
  SMil_00013747-RA_Salv  32 APGFRFRPTDGELIVEYLQKKIDNQPIPV-DGMNETNLKEVNPWDIQAnfpKL-GYEEEWYFFTPRDRKYPNGERPDRGSESGYWKAT 117
                            69***************************.88**************9534333.3578****************************** PP

                    NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            g dk+v++ +++++g +k Lvfy+g+ +kg+kt+W+mheyr+
  SMil_00013747-RA_Salv 118 GADKPVMV-GDATIGFRKALVFYQGKPQKGVKTKWIMHEYRV 158
                            ********.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-5024184IPR003441NAC domain
PROSITE profilePS5100551.26731184IPR003441NAC domain
PfamPF023651.1E-2433158IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MDHQETEQRH SEDEQIRAPA APMAVPAWKS YAPGFRFRPT DGELIVEYLQ KKIDNQPIPV  60
DGMNETNLKE VNPWDIQANF PKLGYEEEWY FFTPRDRKYP NGERPDRGSE SGYWKATGAD  120
KPVMVGDATI GFRKALVFYQ GKPQKGVKTK WIMHEYRVNA PARKKRSKDD MRLDDWVLCH  180
MYEKTKRLPN NKRKNPNAKE AKEQSDDDSD SEFAVVGNDD DDDNEVAAAI ENLPGILPEN  240
PYPFNYYYPE QNPAYLEDIL KQSTFGGYQE ADPSFRDVYF QLDGTVAPPV EEQLGFQQHL  300
ALGFQQHLNI ASSYLNHETL GFQQQLNIAS SYLNHETLGF QQQQPQPNIA SSSQPNIASS  360
SVLRSNEAFF PPNINTNTNF SPPIYNQIDA PIYNPIDPQQ DMKIDAQENM KRFRFRR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-493318417168Stress-induced transcription factor NAC1
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.15e-55NAC domain containing protein 25