PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00013517-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 359aa    MW: 40197.9 Da    PI: 6.5129
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00013517-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.24.6e-51311571128
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                            + pGfrF+Ptdeel+++yLk+k++g++  + evi+evdi+++ePwdLp ++v ++++ew+fFs+r +ky++g++++rat sgyWkatg
  SMil_00013517-RA_Salv  31 MFPGFRFSPTDEELIQYYLKRKLHGSDDGV-EVIPEVDICRHEPWDLPgQSVIQSDNEWFFFSPRGRKYPNGSQSKRATVSGYWKATG 117
                            579************************888.99***************777778899******************************* PP

                    NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            k+++v+s +++++g+k+tLvf+ grapkg++t+W+mhey+ 
  SMil_00013517-RA_Salv 118 KERSVKS-GSTQIGTKRTLVFHMGRAPKGQRTEWIMHEYTT 157
                            *******.999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.62E-5625172IPR003441NAC domain
PROSITE profilePS5100553.94931173IPR003441NAC domain
PfamPF023651.1E-2633156IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0033619Biological Processmembrane protein proteolysis
GO:0048573Biological Processphotoperiodism, flowering
GO:0071472Biological Processcellular response to salt stress
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
LFGCISIGCN ISDNDRSICS MEISIAEASS MFPGFRFSPT DEELIQYYLK RKLHGSDDGV  60
EVIPEVDICR HEPWDLPGQS VIQSDNEWFF FSPRGRKYPN GSQSKRATVS GYWKATGKER  120
SVKSGSTQIG TKRTLVFHMG RAPKGQRTEW IMHEYTTSEK SQDAMVVCRL RKNREFHLND  180
SVGEGAVENS APSVSGLVDG AKTAGSCSKD CSSSHNSHSV EQLDTGSESE EKVTNESSHP  240
VSSLNEEDDC YADIMKDDLI KLDDSSLSEN PRPIRQKLPS QGTANRRLRL RRHRMESYGN  300
GREHFGIYEL EKQTSTREIS IENARDSNLI EKSTRIVFLV AVVLISVLIL LLYIRGSSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-453017419169NAC domain-containing protein 19
3swm_B1e-453017419169NAC domain-containing protein 19
3swm_C1e-453017419169NAC domain-containing protein 19
3swm_D1e-453017419169NAC domain-containing protein 19
3swp_A1e-453017419169NAC domain-containing protein 19
3swp_B1e-453017419169NAC domain-containing protein 19
3swp_C1e-453017419169NAC domain-containing protein 19
3swp_D1e-453017419169NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP), probably via metalloprotease activity. Regulates gibberellic acid-mediated salt-responsive repression of seed germination and flowering via FT, thus delaying seed germination under high salinity conditions. {ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704528, ECO:0000269|PubMed:19704545}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00280DAPTransfer from AT2G27300Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By high salt stress (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Repressed by gibberellic acid (GA), but induced by the GA biosynthetic inhibitor paclabutrazol (PAC) (PubMed:18363782). Accumulates transiently in seeds upon imbibition (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Induced by drought stress (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704528, ECO:0000269|PubMed:19704545}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011088938.11e-142NAC domain-containing protein 40
SwissprotQ9XIN75e-82NAC40_ARATH; NAC domain-containing protein 40
TrEMBLA0A2G9GC161e-138A0A2G9GC16_9LAMI; Uncharacterized protein
STRINGMigut.D02423.1.p1e-131(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22290.11e-75NAC domain containing protein 89
Publications ? help Back to Top
  1. Liang M, et al.
    Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana.
    Traffic, 2015. 16(10): p. 1062-74
    [PMID:26201836]
  2. Tian H, et al.
    NTL8 Regulates Trichome Formation in Arabidopsis by Directly Activating R3 MYB Genes TRY and TCL1.
    Plant Physiol., 2017. 174(4): p. 2363-2375
    [PMID:28649093]