PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00013510-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family G2-like
Protein Properties Length: 360aa    MW: 39397.9 Da    PI: 8.37
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00013510-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.71.3e-3397151155
                G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                            +prlrWt +LHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQkYR+
  SMil_00013510-RA_Salv  97 RPRLRWTADLHERFVDAVTQLGGADKATPKTIMRTMGVKGLTLYHLKSHLQKYRM 151
                            59****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.19294154IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-3295152IPR009057Homeodomain-like
SuperFamilySSF466892.87E-1697152IPR009057Homeodomain-like
TIGRFAMsTIGR015574.0E-2398152IPR006447Myb domain, plants
PfamPF002497.0E-899150IPR001005SANT/Myb domain
PfamPF143793.0E-25195241IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010628Biological Processpositive regulation of gene expression
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
PPPFLTSKTN HNSSKTTQNW IFFPIPSHFA APSILLTYFL QRKPLTLRER GSDRERMYSA  60
LPIHSLAVEA GGGGYPGPLD GTNLPGDACL VLSTDPRPRL RWTADLHERF VDAVTQLGGA  120
DKATPKTIMR TMGVKGLTLY HLKSHLQKYR MGKQAGKELT EVSKDVSCIA ESQDTGSSTS  180
TSSKMMAQDI NDGYQVTEAL RVQMEVQQRL HEQLEVQRRL QIRIEAQSKY LQSILDKACK  240
ALDDQAVASA GLEAARRELS DLAIKVAHDC NGVLSVPPVS CDASDTTDRH SIPRLPARLG  300
DCSMDSGMMS SNGSPISPST LESQAAAALK KRPRPLFSSG ETMPIDGSMR PVEWMMSNFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A9e-1997153258Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B9e-1997153258Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A8e-1997153157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B8e-1997153157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C8e-1997153157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D8e-1997153157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A9e-1997153258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C9e-1997153258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D9e-1997153258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F9e-1997153258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H9e-1997153258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J9e-1997153258Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1330334KRPRP
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00378DAPTransfer from AT3G24120Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011091432.11e-166protein PHR1-LIKE 2 isoform X2
SwissprotQ94A571e-119PHL2_ARATH; Protein PHR1-LIKE 2
TrEMBLA0A4D9BKZ20.0A0A4D9BKZ2_SALSN; Uncharacterized protein
STRINGXP_006493809.11e-143(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37912344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.11e-109G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]