PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00013267-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 331aa    MW: 37654.1 Da    PI: 7.6832
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00013267-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.37.7e-50231482128
                    NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                            +pGfrFhPt+eelv++yL++kvegk+++l e i+ +d+y+++Pw+Lp  ++ +ekewyf+++rd+ky++g+r+nr+t+sgyWkatg d
  SMil_00013267-RA_Salv  23 MPGFRFHPTEEELVDFYLRRKVEGKSFNL-ELITFLDLYRYDPWELPGLAAMGEKEWYFYVPRDRKYRNGDRPNRVTTSGYWKATGAD 109
                            79**************************9.89***************7777899********************************** PP

                    NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            + + s++++ +glkktLvfy+g+apkg +t W+m+eyrl
  SMil_00013267-RA_Salv 110 RIIRSESHRSIGLKKTLVFYSGKAPKGIRTAWIMNEYRL 148
                            *************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100555.26422170IPR003441NAC domain
SuperFamilySSF1019413.14E-5522169IPR003441NAC domain
PfamPF023653.6E-2524148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MNNNNPEESN SSNQDEQEQD MVMPGFRFHP TEEELVDFYL RRKVEGKSFN LELITFLDLY  60
RYDPWELPGL AAMGEKEWYF YVPRDRKYRN GDRPNRVTTS GYWKATGADR IIRSESHRSI  120
GLKKTLVFYS GKAPKGIRTA WIMNEYRLPS MKPNAFKRYA EISLCRVYKR AGLEDQHTRG  180
SSSSCRRGST ASSSSDIGSS TTTSLTLPFI NPLASSTFIP LQDDHHTIMQ PNNSSNLTTN  240
IGTPIFDNAL DDLHKLVNLN FSKDVATSSS LPNHVYYPNV IATDFLSYFP TLQPQPPPAT  300
NISSPAAFSD RLMWDWNAIS ESSKDLTNLF K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-572417019165NO APICAL MERISTEM PROTEIN
1ut4_B3e-572417019165NO APICAL MERISTEM PROTEIN
1ut7_A3e-572417019165NO APICAL MERISTEM PROTEIN
1ut7_B3e-572417019165NO APICAL MERISTEM PROTEIN
4dul_A3e-572417019165NAC domain-containing protein 19
4dul_B3e-572417019165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011087598.11e-122NAC domain-containing protein 35
SwissprotQ9ZVP87e-96NAC35_ARATH; NAC domain-containing protein 35
TrEMBLA0A2G9HIS21e-123A0A2G9HIS2_9LAMI; Uncharacterized protein
STRINGMigut.N00873.1.p1e-112(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38882446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.11e-95NAC domain containing protein 35
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Okajima K
    Molecular mechanism of phototropin light signaling.
    J. Plant Res., 2016. 129(2): p. 149-57
    [PMID:26815763]
  3. Nakasone Y,Ohshima M,Okajima K,Tokutomi S,Terazima M
    Photoreaction Dynamics of LOV1 and LOV2 of Phototropin from Chlamydomonas reinhardtii.
    J Phys Chem B, 2018. 122(6): p. 1801-1815
    [PMID:29355019]