PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00013240-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family Dof
Protein Properties Length: 271aa    MW: 29878.1 Da    PI: 6.4928
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00013240-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof82.25.4e-261171262
                 zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                           +++ l+cprC s +t+f y+nn sl+qPr+ C++C+r Wt GG lr +PvGg +r+ k+s+
  SMil_00013240-RA_Salv 11 PQTPLECPRCGSLDTRFRYFNNNSLTQPRFHCRTCKRQWTVGGRLRLIPVGGNTRNGKSSK 71
                           67889**************************************************999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-14162IPR003851Zinc finger, Dof-type
PfamPF027013.8E-261469IPR003851Zinc finger, Dof-type
PROSITE profilePS5088422.1631569IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MEQSRAEAQQ PQTPLECPRC GSLDTRFRYF NNNSLTQPRF HCRTCKRQWT VGGRLRLIPV  60
GGNTRNGKSS KASSSKGGNS RSQPTKPLPS SGEGHQQHLT LMMAMVSQNF DTTLFQPVTN  120
MPAAISSPNY FSNQISCLDA TRTLMQQVDN QHPSAINLCS SAGTNMSIPQ ERNVQTTAPD  180
KALSQQNSIT FEPYQTHTEA TNAPPSHLCI NGVVQPAWSM NLLPQDIAYD ASFTITNACI  240
PNNLSGDTTD TEDTTYVNVD EWLNFQECDP S
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1614456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.11e-18TARGET OF MONOPTEROS 6