PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00012640-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 331aa    MW: 37407.9 Da    PI: 7.2029
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00012640-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.21.3e-52151441128
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                            + pGfrFhPtdeelv +yL++kv++k+l++ e ik++diyk++PwdLpk+++++ekewyf+++rd+ky+++ r+nr+t +g+Wkatg+
  SMil_00012640-RA_Salv  15 MLPGFRFHPTDEELVGFYLRRKVQHKPLSI-ELIKQLDIYKYDPWDLPKMASTGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKATGT 101
                            579***************************.89***************9889999********************************* PP

                    NAM  89 dkevlsk...kgelvglkktLvfykgrapkgektdWvmheyrl 128
                            d++++s+   + + +glkk+Lvfy+gra +g+ktdW+mhe+rl
  SMil_00012640-RA_Salv 102 DRPIYSSdggGAKCIGLKKSLVFYRGRAARGTKTDWMMHEFRL 144
                            ******98766677***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-5813171IPR003441NAC domain
PROSITE profilePS5100557.0115171IPR003441NAC domain
PfamPF023657.9E-2617144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MEQERIESDD NAEVMLPGFR FHPTDEELVG FYLRRKVQHK PLSIELIKQL DIYKYDPWDL  60
PKMASTGEKE WYFYCPRDRK YRNSARPNRV TGAGFWKATG TDRPIYSSDG GGAKCIGLKK  120
SLVFYRGRAA RGTKTDWMMH EFRLPSASPK KYLDKIIPAH EAWAICRIFK KASSSAQRAL  180
SLSQSWISPL SDDTTMSFCN DLQPSSFSHL NHQWPSNGMQ QNAIFSAPRD ETTSFHDHEQ  240
RAPKISTNDA SSLLLEMSTS VLGDAGFRRL PEPSDGAAAA ENGGGVNDEE WGMMIRYPSY  300
GFALSSNLVW EYSSPCPSEL STAYSTNNCY T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-5571778171NO APICAL MERISTEM PROTEIN
1ut4_B8e-5571778171NO APICAL MERISTEM PROTEIN
1ut7_A8e-5571778171NO APICAL MERISTEM PROTEIN
1ut7_B8e-5571778171NO APICAL MERISTEM PROTEIN
3swm_A9e-55717711174NAC domain-containing protein 19
3swm_B9e-55717711174NAC domain-containing protein 19
3swm_C9e-55717711174NAC domain-containing protein 19
3swm_D9e-55717711174NAC domain-containing protein 19
3swp_A9e-55717711174NAC domain-containing protein 19
3swp_B9e-55717711174NAC domain-containing protein 19
3swp_C9e-55717711174NAC domain-containing protein 19
3swp_D9e-55717711174NAC domain-containing protein 19
4dul_A8e-5571778171NAC domain-containing protein 19
4dul_B8e-5571778171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071000.11e-129putative NAC domain-containing protein 94
SwissprotQ9ZVH03e-94FEZ_ARATH; Protein FEZ
TrEMBLA0A022Q7D41e-127A0A022Q7D4_ERYGU; Uncharacterized protein
STRINGMigut.E00095.1.p1e-128(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22022262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-91NAC family protein
Publications ? help Back to Top
  1. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]