PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00012393-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 241aa    MW: 28113.5 Da    PI: 6.3074
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00012393-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM141.35.5e-4441351128
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                            +p+GfrF Pt+eel+++yL++k++g + ++++vi+ v+iy+++PwdLp+     +++++++w+fF+  ++++a+g r+nr t++gyWk
  SMil_00012393-RA_Salv   4 MPVGFRFYPTEEELLSYYLHHKLSGMNPDIDRVIPLVNIYDYNPWDLPQfageVCRGDREQWFFFTAMQEREARGGRTNRLTQNGYWK 91 
                            699***************************99****************656754455777**************************** PP

                    NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            atg+  +v++ ++   g kkt+vfy+grap+g+kt+W m+ey+l
  SMil_00012393-RA_Salv  92 ATGSPCDVFTCQNLRLGKKKTMVFYEGRAPHGSKTTWKMNEYKL 135
                            **********99999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-482159IPR003441NAC domain
PROSITE profilePS5100548.534159IPR003441NAC domain
PfamPF023657.5E-225135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MVDMPVGFRF YPTEEELLSY YLHHKLSGMN PDIDRVIPLV NIYDYNPWDL PQFAGEVCRG  60
DREQWFFFTA MQEREARGGR TNRLTQNGYW KATGSPCDVF TCQNLRLGKK KTMVFYEGRA  120
PHGSKTTWKM NEYKLYHQSS AAASPQLKEE LSLCRIYKRS KCARPFDRRP PAEAPAAHDE  180
AARQYYDDHH HRSIADVAVA SNDNQQNPAV GTEFTNWDMQ TQTEPLWDSE DLLMILNWFD  240
L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-35216415170NO APICAL MERISTEM PROTEIN
1ut4_B9e-35216415170NO APICAL MERISTEM PROTEIN
1ut7_A9e-35216415170NO APICAL MERISTEM PROTEIN
1ut7_B9e-35216415170NO APICAL MERISTEM PROTEIN
3swm_A1e-34216418173NAC domain-containing protein 19
3swm_B1e-34216418173NAC domain-containing protein 19
3swm_C1e-34216418173NAC domain-containing protein 19
3swm_D1e-34216418173NAC domain-containing protein 19
3swp_A1e-34216418173NAC domain-containing protein 19
3swp_B1e-34216418173NAC domain-containing protein 19
3swp_C1e-34216418173NAC domain-containing protein 19
3swp_D1e-34216418173NAC domain-containing protein 19
4dul_A9e-35216415170NAC domain-containing protein 19
4dul_B9e-35216415170NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011077925.12e-88NAC domain-containing protein 90-like
TrEMBLA0A4D8Z4J01e-126A0A4D8Z4J0_SALSN; Uncharacterized protein
STRINGXP_010271606.12e-80(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24942357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44350.21e-64NAC domain containing protein 61