PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00012309-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family Dof
Protein Properties Length: 335aa    MW: 36710.9 Da    PI: 9.7086
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00012309-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.81.3e-39106167263
                 zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                            k++a++cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  SMil_00012309-RA_Salv 106 KDQAINCPRCHSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGTLRNVPVGGGSRKNKRSSS 167
                            7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2498155IPR003851Zinc finger, Dof-type
PfamPF027011.4E-33107164IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.863110164IPR003851Zinc finger, Dof-type
PROSITE patternPS013610112148IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
NKQSTAFPLF PPIIHKVSQL KKKKANIQTT QKHSFLASKT AADKLGEFSP SLCLFVITPP  60
FFPSSETSMD SAQWTQEFGV ARSMAEGGPN ACSSKPSTER KVRPQKDQAI NCPRCHSTNT  120
KFCYYNNYSL TQPRYFCKTC RRYWTEGGTL RNVPVGGGSR KNKRSSSSSS IITPHKLPDL  180
NPPFSSQNPN PKIHDQAGQD LNLGFQPDYT HFLDTSNANT SSSTTTTPLS PLNFFTNGGI  240
AARGFFPLHD QNSAIFASAG FPFQECKPPQ LSFPVAVGGS RTESSYNVPQ ENNANIGSLM  300
FTLGAARRNS SDQDQDKGHE NSNGFWNGML GGASW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022898416.17e-81dof zinc finger protein DOF2.5-like isoform X1
TrEMBLA0A4D8YDZ61e-115A0A4D8YDZ6_SALSN; Uncharacterized protein
STRINGMigut.B01894.1.p4e-77(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.32e-43Dof family protein