PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00012083-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family Dof
Protein Properties Length: 230aa    MW: 23463 Da    PI: 8.4938
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00012083-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.23.7e-382180362
                 zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                            ++l+cprC stntkfCyynny+ sqPr+fCkaCrryWt+GG+lr++PvGgg+rkn k+s
  SMil_00012083-RA_Salv 21 PEHLPCPRCSSTNTKFCYYNNYNFSQPRHFCKACRRYWTHGGTLRDIPVGGGSRKNAKRS 80
                           57899***************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027014.8E-332378IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.0122478IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102662IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-192869IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MATDTAERKA ARSGQAPPPE PEHLPCPRCS STNTKFCYYN NYNFSQPRHF CKACRRYWTH  60
GGTLRDIPVG GGSRKNAKRS RSSAAAAGGG AFSPSPHHDF RGFPGGASQL LVPFAADHGG  120
AGAFSGDAKM CGSFTSLLNT QGAGLWALGG FGLGLGHGFE EVGFGLGRAV WPFPGVVEGG  180
PASGGGGGGG GASVAGNTWQ LESGESGYSN GDCFALPDLA ISTPGGNFMK
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin and salicylic acid (SA). {ECO:0000269|PubMed:10758484}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP6629225e-81KP662922.1 Cajanus cajan Dof38 (Dof38) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099306.11e-111dof zinc finger protein DOF3.4
SwissprotQ390884e-52DOF34_ARATH; Dof zinc finger protein DOF3.4
TrEMBLA0A4D8ZYI21e-113A0A4D8ZYI2_SALSN; Uncharacterized protein
STRINGMigut.H00486.1.p1e-108(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45322241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50410.12e-29OBF binding protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]