PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00011788-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family G2-like
Protein Properties Length: 374aa    MW: 42162.1 Da    PI: 9.6873
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00011788-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.71.9e-3180133255
                G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                            prlrWtp+LH +Fv+a+e+LGG+e+AtPk++l+lm+v gL+++hvkSHLQ+YR+
  SMil_00011788-RA_Salv  80 PRLRWTPDLHLSFVHAIERLGGQERATPKAVLQLMNVRGLSISHVKSHLQMYRS 133
                            8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.40976136IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-2976134IPR009057Homeodomain-like
SuperFamilySSF466891.61E-1478134IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-2380135IPR006447Myb domain, plants
PfamPF002492.3E-881132IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MSISGEDNMA SSDSSENLSS IDLNEEAGSN VVGDPMIEMS GISIQEARDE RSGDDSSKSE  60
DGHAKDKKNS VRQYVRSKMP RLRWTPDLHL SFVHAIERLG GQERATPKAV LQLMNVRGLS  120
ISHVKSHLQM YRSKKLDESG RVIGQANRIY IQGRGYLSSS SSAYNEKCSP FHELRMENGG  180
IVFARNHLDC STPFPQNLKS HHSLSSSRYH PWSSYRHEPK IRVEPGLISE VGTLEKRSIS  240
SKYIHALHES YGPLRPSQLL QGRRWPHIQN QSKEKEISKS NNIWSSSQSL RPQSRWINNN  300
SIHKSSFNLD RLQLMNEERK MERKEWFPAD LKLGLSLSLS SNNDQKGCSK DGGDHSDINT  360
KLSLALTPHS STAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-1781135357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-1781135357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-1781135357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-1781135357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101395.11e-138myb-related protein 2
RefseqXP_020546992.11e-138myb-related protein 2
TrEMBLA0A4D9ARE91e-170A0A4D9ARE9_SALSN; Uncharacterized protein
STRINGMigut.M01030.1.p2e-66(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55162334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.13e-37G2-like family protein