PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00011315-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 535aa    MW: 60670.9 Da    PI: 6.0056
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00011315-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM182.51.1e-5661331128
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                            lppGfrFhPtdeelv +yLk+k++g+k++l e+i+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratk+gyWkat
  SMil_00011315-RA_Salv   6 LPPGFRFHPTDEELVAYYLKRKINGRKIDL-EIIPEVDLYKCEPWDLPgKsLLPSKDLEWYFFSPRDRKYPNGSRTNRATKAGYWKAT 92 
                            79****************************.99***************6434555777****************************** PP

                    NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            gkd++v s ++++vg+kktLv+y+grap+g +tdWvmheyrl
  SMil_00011315-RA_Salv  93 GKDRKVNS-QTRAVGMKKTLVYYRGRAPHGARTDWVMHEYRL 133
                            ********.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-644157IPR003441NAC domain
PROSITE profilePS5100561.9796157IPR003441NAC domain
PfamPF023652.8E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 535 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELV AYYLKRKING RKIDLEIIPE VDLYKCEPWD LPGKSLLPSK  60
DLEWYFFSPR DRKYPNGSRT NRATKAGYWK ATGKDRKVNS QTRAVGMKKT LVYYRGRAPH  120
GARTDWVMHE YRLDDRECDT PSSGLQDAYA LCRVFKKSLN IPKVGENYVT HPSSTPNYED  180
PPDPSWAHYL SEEAFAFTNN PYPNCAPIFN PPSKVDIALE CARLQHRFSL PPLEVQDYPP  240
AGFPMDQRMQ YSNAFHGNTD QPADIVQEIL SVAQASQQLQ NQETFSGNYA LSDDFSFLLH  300
APDIGSSRYL DNVGEGHNQR SIDIGDNDQF SQTGRMVENL RWVGMSNKEL EKAFVDDFKT  360
VPIENISNIP RDYHDFQGES SNHNFNTFIN TETNDNISIA PRDDHHNVSS DNFLDDGDID  420
DFSSTPNFEL YGKVEVNHGL LVSTRQTPNT FYHKVVPSKT VQVQMNPIII PISKSGFLAS  480
PKMGSSMLKM MKSQDEEDGS SKGRLCGEVM KNIRSYVTFA VALCAIWVRI VTPFA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-55115712165NO APICAL MERISTEM PROTEIN
1ut4_B2e-55115712165NO APICAL MERISTEM PROTEIN
1ut7_A2e-55115712165NO APICAL MERISTEM PROTEIN
1ut7_B2e-55115712165NO APICAL MERISTEM PROTEIN
3swm_A2e-55115715168NAC domain-containing protein 19
3swm_B2e-55115715168NAC domain-containing protein 19
3swm_C2e-55115715168NAC domain-containing protein 19
3swm_D2e-55115715168NAC domain-containing protein 19
3swp_A2e-55115715168NAC domain-containing protein 19
3swp_B2e-55115715168NAC domain-containing protein 19
3swp_C2e-55115715168NAC domain-containing protein 19
3swp_D2e-55115715168NAC domain-containing protein 19
4dul_A2e-55115712165NAC domain-containing protein 19
4dul_B2e-55115712165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096933.10.0NAC domain-containing protein 45
TrEMBLA0A2G9GMX50.0A0A2G9GMX5_9LAMI; Uncharacterized protein
STRINGMigut.K00745.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14952348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-141NAC domain containing protein 28