PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00010794-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 532aa    MW: 59050.3 Da    PI: 4.2698
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00010794-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.82.1e-53131401128
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                            l+pGfrFhPtdeelv +yL++kv g+ +++ ++i+++diyk+ePwdLp  +k+k+++ ewyfFs  dkky +g r+nrat++gyWk+t
  SMil_00010794-RA_Salv  13 LAPGFRFHPTDEELVRYYLRRKVCGRGFRF-HAISDIDIYKAEPWDLPsfSKLKTRDLEWYFFSVLDKKYGNGARTNRATEKGYWKTT 99 
                            579*************************99.88***************5448888888****************************** PP

                    NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            gkd++v++ +g+ vg+kktLv++ grapkg++t+Wvmheyrl
  SMil_00010794-RA_Salv 100 GKDRAVYH-RGQIVGMKKTLVYHIGRAPKGQRTNWVMHEYRL 140
                            ********.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-6211163IPR003441NAC domain
PROSITE profilePS5100557.87413163IPR003441NAC domain
PfamPF023651.2E-2715140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    Send to blast
MEIAGKKKSS SMLAPGFRFH PTDEELVRYY LRRKVCGRGF RFHAISDIDI YKAEPWDLPS  60
FSKLKTRDLE WYFFSVLDKK YGNGARTNRA TEKGYWKTTG KDRAVYHRGQ IVGMKKTLVY  120
HIGRAPKGQR TNWVMHEYRL TDLELERAGI HQDAFVLCRV FQKSGSGPKN GEQYGAPFVE  180
EEWLDDESDL ILKAEAAEEV DFEDDAYLDG DDLEQILGSD IPSADSPLQS NCQPADGNFV  240
EETAESVHDG PKLLVNAGDQ YCEPEQHEDK NLYDIPAPYD MDVRAVKHEF IGECSKSGNS  300
DELDFLLDEP LQENPDDLPY GSVGFIEASD LSHPVEANTS PQDMLEEFFT FYDANIDNSQ  360
DFAYDSLAML GSEDLIPDQL LLPPEEPEVG GDLSTLPSGG QPLDNNNGDA ASSSDKLDSS  420
TYESDFQYPF LKQASQMLGS IPAPPALAAE FPSKDVVHRL NSLSQPSTSV HVTAGMIQIR  480
NLSTNDNGVD QLLSKPANLN IVLSFGYSRG EDGSAHLESS VSLLPGKTVP TL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-481316920174NAC domain-containing protein 19
3swm_B2e-481316920174NAC domain-containing protein 19
3swm_C2e-481316920174NAC domain-containing protein 19
3swm_D2e-481316920174NAC domain-containing protein 19
3swp_A2e-481316920174NAC domain-containing protein 19
3swp_B2e-481316920174NAC domain-containing protein 19
3swp_C2e-481316920174NAC domain-containing protein 19
3swp_D2e-481316920174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011076897.10.0NAC domain-containing protein 53 isoform X1
TrEMBLA0A2G9I3Z20.0A0A2G9I3Z2_9LAMI; Uncharacterized protein
STRINGMigut.F01913.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31412450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.11e-121NAC domain containing protein 2