PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00010793-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 410aa    MW: 46116 Da    PI: 5.0629
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00010793-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.24.7e-51441711128
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                            l+pGfrFhPtdeelv +yL++k+ gk++++ +++ e+d+yk+ePw+L   +++k+++ ewyfFs+ d+ky +g+r nrat +gyWkat
  SMil_00010793-RA_Salv  44 LAPGFRFHPTDEELVRYYLRRKACGKPFRF-QAVIEIDVYKSEPWELAdySSLKTRDLEWYFFSPVDRKYGNGSRLNRATGKGYWKAT 130
                            579**************************9.77999***********84347777888****************************** PP

                    NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            gkd++v + k+ ++g+kktLvf++grap+g++t+Wvmheyrl
  SMil_00010793-RA_Salv 131 GKDRAVRH-KNLTIGMKKTLVFHSGRAPDGKRTNWVMHEYRL 171
                            ********.8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-6241194IPR003441NAC domain
PROSITE profilePS5100557.35244194IPR003441NAC domain
PfamPF023654.4E-2846171IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
LLLLFFFSFF FVVVGGSGEF RCWKMGQEVA VVGTAAGAPP PTSLAPGFRF HPTDEELVRY  60
YLRRKACGKP FRFQAVIEID VYKSEPWELA DYSSLKTRDL EWYFFSPVDR KYGNGSRLNR  120
ATGKGYWKAT GKDRAVRHKN LTIGMKKTLV FHSGRAPDGK RTNWVMHEYR LCDSELERAG  180
VTQDAFVLCR IFQKSGLGPP NGDRYAPFVE EEWDEDAVVV VPGGDAEDDV ANGDDARVEC  240
TDLDQETPPL SMAPPQVENT TGTQSLTFMC KRERSEEPEP LSLAQSKRGK AENPNSSHAN  300
GSEDSTTTSQ DPCTMMMTTN FTSGLLEFPL LEPKENQPGS TLTFDSSNLE KSVPPGYLKF  360
ISNLENEILN VSMERETLKI EVMRAQAMIN ILQSRVELVT KENEELRRRA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-514319416165NO APICAL MERISTEM PROTEIN
1ut4_B4e-514319416165NO APICAL MERISTEM PROTEIN
1ut7_A4e-514319416165NO APICAL MERISTEM PROTEIN
1ut7_B4e-514319416165NO APICAL MERISTEM PROTEIN
3swm_A4e-514319419168NAC domain-containing protein 19
3swm_B4e-514319419168NAC domain-containing protein 19
3swm_C4e-514319419168NAC domain-containing protein 19
3swm_D4e-514319419168NAC domain-containing protein 19
3swp_A4e-514319419168NAC domain-containing protein 19
3swp_B4e-514319419168NAC domain-containing protein 19
3swp_C4e-514319419168NAC domain-containing protein 19
3swp_D4e-514319419168NAC domain-containing protein 19
4dul_A4e-514319416165NAC domain-containing protein 19
4dul_B4e-514319416165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that binds to the motif 5'-(C/T)A(C/A)G-3' in the promoter of target genes (PubMed:25578968). Binds also to the 5'-CTTGNNNNNCAAG-3' consensus sequence in chromatin (PubMed:26617990). Can bind to the mitochondrial dysfunction motif (MDM) present in the upstream regions of mitochondrial dysfunction stimulon (MDS) genes involved in mitochondrial retrograde regulation (MRR) (PubMed:24045019). Together with NAC050 and JMJ14, regulates gene expression and flowering time by associating with the histone demethylase JMJ14, probably by the promotion of RNA-mediated gene silencing (PubMed:25578968, PubMed:26617990). Regulates siRNA-dependent post-transcriptional gene silencing (PTGS) through SGS3 expression modulation (PubMed:28207953). Required during pollen development (PubMed:19237690). {ECO:0000269|PubMed:19237690, ECO:0000269|PubMed:24045019, ECO:0000269|PubMed:25578968, ECO:0000269|PubMed:26617990, ECO:0000269|PubMed:28207953}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00612ChIP-seqTransfer from AT3G10490Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by type III effector proteins (TTEs) secreted by the pathogenic bacteria P.syringae pv. tomato DC3000 during basal defense. {ECO:0000269|PubMed:16553893}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101542.10.0NAC domain-containing protein 78 isoform X2
SwissprotQ9SQY01e-113NAC52_ARATH; NAC domain containing protein 52
TrEMBLA0A2U5FKN30.0A0A2U5FKN3_SALMI; NAC domain containing protein 2
STRINGXP_009619467.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31402448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.21e-106NAC domain containing protein 50
Publications ? help Back to Top
  1. Higgins JD,Ferdous M,Osman K,Franklin FC
    The RecQ helicase AtRECQ4A is required to remove inter-chromosomal telomeric connections that arise during meiotic recombination in Arabidopsis.
    Plant J., 2011. 65(3): p. 492-502
    [PMID:21265901]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Zhang S, et al.
    C-terminal domains of a histone demethylase interact with a pair of transcription factors and mediate specific chromatin association.
    Cell Discov, 2019.
    [PMID:26617990]
  4. Butel N,Le Masson I,Bouteiller N,Vaucheret H,Elmayan T
    sgs1: a neomorphic nac52 allele impairing post-transcriptional gene silencing through SGS3 downregulation.
    Plant J., 2017. 90(3): p. 505-519
    [PMID:28207953]
  5. Elmayan T, et al.
    Arabidopsis mutants impaired in cosuppression.
    Plant Cell, 1998. 10(10): p. 1747-58
    [PMID:9761800]