PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00010382-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 317aa    MW: 36200 Da    PI: 9.6265
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00010382-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.11.2e-55101381128
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                            +ppGfrFhPtdeelv +yL+kkv++++++l +vi+++d+y++ePwdL++     ++e+kewyfFs++dkky++g+r+nrat +g+Wka
  SMil_00010382-RA_Salv  10 VPPGFRFHPTDEELVGYYLRKKVASQRIDL-DVIRDIDLYRIEPWDLQEkcgIGYEEQKEWYFFSHKDKKYPSGTRTNRATMAGFWKA 96 
                            69****************************.9***************953543334778***************************** PP

                    NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            tg+dk+v++ +++l+g++ktLvfykgrap+g+ktdW+mheyrl
  SMil_00010382-RA_Salv  97 TGRDKAVYD-RSKLIGMRKTLVFYKGRAPNGQKTDWIMHEYRL 138
                            *********.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-574143IPR003441NAC domain
PROSITE profilePS5100554.66910158IPR003441NAC domain
PfamPF023657.1E-2911138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MMDSAAECCV PPGFRFHPTD EELVGYYLRK KVASQRIDLD VIRDIDLYRI EPWDLQEKCG  60
IGYEEQKEWY FFSHKDKKYP SGTRTNRATM AGFWKATGRD KAVYDRSKLI GMRKTLVFYK  120
GRAPNGQKTD WIMHEYRLDS ELNSPPQACF FLPSLFISFQ KHTHTYNIKY IKLILRDGER  180
ISDRFGGDAR KGDDGGFSHI SRSWASKGRT TKKGRVFDSS IKHRLRRIIK NGMNMSKSRA  240
DGAVLQGAGA HFVSSSPVEF LNKVQHAQNG GAILQNFVIH SSSDAARAMS VVVSKRWGDM  300
LDDDDSLDED ESLNIFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-5231388140Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021908313.13e-99NAC domain-containing protein 37-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36160.12e-82NAC domain containing protein 76