PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00009935-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 271aa    MW: 31236.4 Da    PI: 6.351
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00009935-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.56.6e-50141411128
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                            +ppGfrFhPtd e++++yL +kv + ++++ + i++++++++ePwdLp k++k +e+ew+fF++++ ky++g+r+nrat+sgyWk+tg
  SMil_00009935-RA_Salv  14 MPPGFRFHPTDLEIITHYLLNKVLDVRFRA-QPIRDIHLNNFEPWDLPpKAAKMGENEWFFFFEKECKYPSGRRTNRATASGYWKSTG 100
                            79***************************9.88**************978888999******************************** PP

                    NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            kd+e++++++ +vg+kktLvfykgrapk++kt+Wv+ eyrl
  SMil_00009935-RA_Salv 101 KDREIHNATKMVVGMKKTLVFYKGRAPKAHKTNWVIREYRL 141
                            ***************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.28E-5710166IPR003441NAC domain
PROSITE profilePS5100553.46314166IPR003441NAC domain
PfamPF023655.2E-2615141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MEEEEEESSA VAEMPPGFRF HPTDLEIITH YLLNKVLDVR FRAQPIRDIH LNNFEPWDLP  60
PKAAKMGENE WFFFFEKECK YPSGRRTNRA TASGYWKSTG KDREIHNATK MVVGMKKTLV  120
FYKGRAPKAH KTNWVIREYR LHGDFSAYNL SHHAKEKWVV CRVFHKKDVP VVDPPLPPLT  180
DHYSSEKASL SFATDEIIKP SALNSCEDGL SWWSPNLTDK PNSRILYTGG NEIERLMEMA  240
TADCEKEISD GSNKACEGLC DILDMDSLWT Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-4211674166NO APICAL MERISTEM PROTEIN
1ut4_B2e-4211674166NO APICAL MERISTEM PROTEIN
1ut7_A2e-4211674166NO APICAL MERISTEM PROTEIN
1ut7_B2e-4211674166NO APICAL MERISTEM PROTEIN
3swm_A2e-4211677169NAC domain-containing protein 19
3swm_B2e-4211677169NAC domain-containing protein 19
3swm_C2e-4211677169NAC domain-containing protein 19
3swm_D2e-4211677169NAC domain-containing protein 19
3swp_A2e-4211677169NAC domain-containing protein 19
3swp_B2e-4211677169NAC domain-containing protein 19
3swp_C2e-4211677169NAC domain-containing protein 19
3swp_D2e-4211677169NAC domain-containing protein 19
4dul_A2e-4211674166NAC domain-containing protein 19
4dul_B2e-4211674166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that acts as positive regulator of leaf senescence. Activates NYC1, SGR1, SGR2 and PAO, which are genes involved in chlorophyll catabolic processes. Activates senescence-associated genes, such as RNS1, SAG12 and SAG13. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed post-transcriptionally by miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808, ECO:0000269|PubMed:18305205, ECO:0000305|PubMed:15723790}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011078584.12e-75NAC domain-containing protein 92
SwissprotQ9FLR33e-67NAC79_ARATH; NAC domain-containing protein 79
SwissprotQ9SQQ64e-67NAC46_ARATH; NAC domain-containing protein 46
TrEMBLA0A1U8BIE11e-70A0A1U8BIE1_NELNU; NAC domain-containing protein 72-like
STRINGXP_010276452.12e-71(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04060.11e-69NAC domain containing protein 46
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Vidal EA,Álvarez JM,Gutiérrez RA
    Nitrate regulation of AFB3 and NAC4 gene expression in Arabidopsis roots depends on NRT1.1 nitrate transport function.
    Plant Signal Behav, 2014. 9(3): p. e28501
    [PMID:24642706]
  4. Oda-Yamamizo C, et al.
    Corrigendum: The NAC transcription factor ANAC046 is a positive regulator of chlorophyll degradation and senescence in Arabidopsis leaves.
    Sci Rep, 2016. 6: p. 35125
    [PMID:27759025]
  5. O'Shea C, et al.
    Structures and Short Linear Motif of Disordered Transcription Factor Regions Provide Clues to the Interactome of the Cellular Hub Protein Radical-induced Cell Death1.
    J. Biol. Chem., 2017. 292(2): p. 512-527
    [PMID:27881680]
  6. Lee MH,Jeon HS,Kim HG,Park OK
    An Arabidopsis NAC transcription factor NAC4 promotes pathogen-induced cell death under negative regulation by microRNA164.
    New Phytol., 2017. 214(1): p. 343-360
    [PMID:28032643]