PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00009272-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 530aa    MW: 59578.8 Da    PI: 4.6869
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00009272-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM98.11.3e-3048051128
                    NAM  51 vkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            +++++++w+fFs+rd+ky++g r+nrat +gyWk tgkd+ +   ++++vg+kktLvfy+grapkge+tdWvmhey++
  SMil_00009272-RA_Salv   4 LQTGDRQWFFFSPRDRKYPKGGRSNRATGHGYWKVTGKDRVISY-GSRVVGTKKTLVFYRGRAPKGERTDWVMHEYTM 80 
                            567899************************************99.9******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100537.6911103IPR003441NAC domain
SuperFamilySSF1019417.32E-365103IPR003441NAC domain
PfamPF023655.7E-141079IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 530 aa     Download sequence    Send to blast
MSKLQTGDRQ WFFFSPRDRK YPKGGRSNRA TGHGYWKVTG KDRVISYGSR VVGTKKTLVF  60
YRGRAPKGER TDWVMHEYTM DEEEFKRCQD AKGYYALYKV YKKSGPGPKN GEQYGAPFRE  120
EEWDEDLEVQ CPLEPDKPIK RAHETMPVDN TKTVDCQHPS SLDELEEVLN RIATEPDSVQ  180
PPIVDREYAL DQFLGEETES TLIHHSFVDV SVPVVHPAHC DLSETTQLQS QVAPDPSSAT  240
FVNMEDPNVT EEDFLKDYLE MDDLDSDPNV RSHDNWGNYF GSLQFEDFDG LDNLYEDASS  300
FLSEPVEPWQ APQSSMDNFD NGVMDPSSSS YMNRFDNTTQ NYLMRQEANN LDGASSQLWR  360
CEPSYSVVST SKVNQDFNAS STSVILFFHQ SKRALVIFRA VKNSHSPTGD GGSAPYQNQN  420
NGFVNGGNKN GRGKQDDDTD SWFSSAVWSF LESIPTSPAS ASEGPWVNGA CEPTQMCSLS  480
RVRVDVRNTA TSRKIGKSSF GFLCFSILGV ICAILWLLTG ISKRVIGLCS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-28710369165NO APICAL MERISTEM PROTEIN
1ut4_B4e-28710369165NO APICAL MERISTEM PROTEIN
1ut7_A4e-28710369165NO APICAL MERISTEM PROTEIN
1ut7_B4e-28710369165NO APICAL MERISTEM PROTEIN
4dul_A4e-28710369165NAC domain-containing protein 19
4dul_B4e-28710369165NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011074131.10.0NAC domain-containing protein 17-like
TrEMBLA0A4D8XR000.0A0A4D8XR00_SALSN; Uncharacterized protein
STRINGMigut.N02932.1.p1e-158(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32122451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.16e-92NAC domain containing protein 17