PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00009271-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 596aa    MW: 67113.2 Da    PI: 4.6426
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00009271-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.25.4e-52461722128
                    NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                            ppGfrFhPtdeelv +yLk+k+  +++ l +vi+e+d+yk++P++Lp  +k+k+++++w+fFs+rd+ky++g r+nrat++gyWkatg
  SMil_00009271-RA_Salv  46 PPGFRFHPTDEELVLYYLKRKICCQRHLL-DVIAETDVYKWDPEELPglSKLKTGDRQWFFFSPRDRKYPNGARSNRATRHGYWKATG 132
                            9*************************777.9****************6559999********************************** PP

                    NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            kd+ + + + ++vglkktLvfy+grapkge+tdWvmhey++
  SMil_00009271-RA_Salv 133 KDRVISC-GARAVGLKKTLVFYRGRAPKGERTDWVMHEYTM 172
                            ******9.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-5937195IPR003441NAC domain
PROSITE profilePS5100555.98445195IPR003441NAC domain
PfamPF023651.7E-2746171IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 596 aa     Download sequence    Send to blast
LLGFSQSQTR TPHTLKPHKH SPPFSGLFSG NMKVKSDISG DGNVFPPGFR FHPTDEELVL  60
YYLKRKICCQ RHLLDVIAET DVYKWDPEEL PGLSKLKTGD RQWFFFSPRD RKYPNGARSN  120
RATRHGYWKA TGKDRVISCG ARAVGLKKTL VFYRGRAPKG ERTDWVMHEY TMDEEELKRC  180
QAATEYFVLY KVYKKSGPGP KNGEQYGAPF REEDWADDEA EVPSPIEKEI ILNPVNETPP  240
ANITKLVDFQ DLSSLDYLEE IMNQIVDEPL PVQPPVVDHE FNLDQFAGEE TYSSLVGKSS  300
RDISLAAPQP FLQQPILATS FDLTQSGTSQ FQTTDAPEVS SAPVANVLNS RATDETFVED  360
FLELNDLGPD PTAQNPGELV KDMDEFPFDD LDCLHELELF QDAPLFLCDA GPDESRQTSQ  420
SYTNSFRNGA IDPTSSCYMN NVENTTTYIL QQHFNNSDGI SYEMSTDGQS CSVVTEAHTN  480
QGFVPPSTSA LGQMDGMEDH VIFKMVKTLM PKWKVGEFEP ASRALLELNL FRLFTNILAD  540
FAMFRLWFSS ALWSFVESIP TTPASASESA LVNRAFERMS SFGRVRMNAR NLNVTA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-484520117171NO APICAL MERISTEM PROTEIN
1ut4_B1e-484520117171NO APICAL MERISTEM PROTEIN
1ut7_A1e-484520117171NO APICAL MERISTEM PROTEIN
1ut7_B1e-484520117171NO APICAL MERISTEM PROTEIN
3swm_A1e-484520120174NAC domain-containing protein 19
3swm_B1e-484520120174NAC domain-containing protein 19
3swm_C1e-484520120174NAC domain-containing protein 19
3swm_D1e-484520120174NAC domain-containing protein 19
3swp_A1e-484520120174NAC domain-containing protein 19
3swp_B1e-484520120174NAC domain-containing protein 19
3swp_C1e-484520120174NAC domain-containing protein 19
3swp_D1e-484520120174NAC domain-containing protein 19
4dul_A1e-484520117171NAC domain-containing protein 19
4dul_B1e-484520117171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011074131.10.0NAC domain-containing protein 17-like
TrEMBLA0A4D8XR000.0A0A4D8XR00_SALSN; Uncharacterized protein
STRINGMigut.N02932.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32122451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-110NAC domain containing protein 17