PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00008651-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family LFY
Protein Properties Length: 123aa    MW: 13976 Da    PI: 9.9137
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00008651-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY249.21.8e-762108280386
                FLO_LFY 280 kvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsi 367
                            +vtnqvfryakkaga+yinkPkmrhYvhCYalhcLdee+snalrrafkergenvGawrqacykplva+aarqgwdida+fnahprLsi
  SMil_00008651-RA_Salv   2 QVTNQVFRYAKKAGANYINKPKMRHYVHCYALHCLDEETSNALRRAFKERGENVGAWRQACYKPLVAVAARQGWDIDAIFNAHPRLSI 89 
                            69************************************************************************************** PP

                FLO_LFY 368 WYvPtkLrqLChlerskas 386
                            WYvPtkLrqLCh+ers+++
  SMil_00008651-RA_Salv  90 WYVPTKLRQLCHAERSTTA 108
                            ***************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016982.9E-742107IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 123 aa     Download sequence    Send to blast
MQVTNQVFRY AKKAGANYIN KPKMRHYVHC YALHCLDEET SNALRRAFKE RGENVGAWRQ  60
ACYKPLVAVA ARQGWDIDAI FNAHPRLSIW YVPTKLRQLC HAERSTTAAS SSITAAGVDH  120
LPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A4e-69211858174PROTEIN LEAFY
2vy2_A4e-69211858174PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMay regulate indeterminacy during leaf and flower development.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5240321e-148AY524032.1 Salvia coccinea floricaula (FLO) mRNA, FLOA2 paralog, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012856831.11e-77PREDICTED: floricaula protein-like
SwissprotO485596e-75UNI_PEA; Protein UNIFOLIATA
TrEMBLA0A4D8ZXL45e-84A0A4D8ZXL4_SALSN; Uncharacterized protein
STRINGMigut.I00669.1.p4e-77(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA66682333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.16e-71floral meristem identity control protein LEAFY (LFY)