PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00008289-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 275aa    MW: 31648.3 Da    PI: 6.5844
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00008289-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.51.6e-50101381129
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                            lppGfrF P+deelv++yL kk++++++    ++ e+d++ +ePw+Lp  +k +++ewyfFs rd+kyatg r+nrat sgyWkatgk
  SMil_00008289-RA_Salv  10 LPPGFRFYPSDEELVCHYLYKKITNEEVLR-GTLVEIDLHVCEPWQLPDVAKLNSNEWYFFSFRDRKYATGFRTNRATVSGYWKATGK 96 
                            79*************************666.78***************87778899******************************** PP

                    NAM  89 dkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrle 129
                            d++vl+  ++++vg++ktLvfyk+rap+g+kt W+mhe+rle
  SMil_00008289-RA_Salv  97 DRTVLDPrTKAVVGMRKTLVFYKNRAPNGTKTGWIMHEFRLE 138
                            ******866778***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.32E-619156IPR003441NAC domain
PROSITE profilePS5100557.7310156IPR003441NAC domain
PfamPF023658.2E-2811137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MGLRDIGETL PPGFRFYPSD EELVCHYLYK KITNEEVLRG TLVEIDLHVC EPWQLPDVAK  60
LNSNEWYFFS FRDRKYATGF RTNRATVSGY WKATGKDRTV LDPRTKAVVG MRKTLVFYKN  120
RAPNGTKTGW IMHEFRLENP HVPPKEDWVL CRVFHKSRSE NSNNFNFDDP SVLATSPNLA  180
TNNEVRLNIT HQNIITSFQS QQGGPNPNPS TSLGLDFDLS RHHHLPYCSA SHDYSHNKMA  240
EATKNEDDYG FLFDFDGPNA VEDMRFVDDS SSVFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-47915916168NO APICAL MERISTEM PROTEIN
1ut4_B2e-47915916168NO APICAL MERISTEM PROTEIN
1ut7_A2e-47915916168NO APICAL MERISTEM PROTEIN
1ut7_B2e-47915916168NO APICAL MERISTEM PROTEIN
3swm_A2e-47915919171NAC domain-containing protein 19
3swm_B2e-47915919171NAC domain-containing protein 19
3swm_C2e-47915919171NAC domain-containing protein 19
3swm_D2e-47915919171NAC domain-containing protein 19
3swp_A2e-47915919171NAC domain-containing protein 19
3swp_B2e-47915919171NAC domain-containing protein 19
3swp_C2e-47915919171NAC domain-containing protein 19
3swp_D2e-47915919171NAC domain-containing protein 19
4dul_A2e-47915916168NAC domain-containing protein 19
4dul_B2e-47915916168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011080062.11e-125protein CUP-SHAPED COTYLEDON 3
SwissprotQ84TE63e-62NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A2G9HEI91e-132A0A2G9HEI9_9LAMI; Uncharacterized protein
STRINGMigut.D00437.1.p1e-119(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.14e-94NAC domain containing protein 74
Publications ? help Back to Top
  1. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  4. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  5. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  6. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]