PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00008150-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 420aa    MW: 47771.4 Da    PI: 9.8281
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00008150-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.98.3e-1952105356
                            --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            k+++++ +q+++Le+ Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  SMil_00008150-RA_Salv  52 KKRRLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWK 105
                            566899***********************************************9 PP

2NAM109.53.9e-34184277198
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                            lppGfrFhPtdeelvv+yLk+kv + ++++ ++i+evd++k++PwdLp     +e+e yfFs+++ ky++g+r+nrat sgyWkatg 
  SMil_00008150-RA_Salv 184 LPPGFRFHPTDEELVVQYLKRKVLSCPVPA-SIIPEVDMCKSDPWDLP---GDSEQERYFFSTKQVKYPNGNRSNRATVSGYWKATGL 267
                            79***************************9.89***************...3467899****************************** PP

                    NAM  89 dkevlskkge 98 
                            dk+++ ++++
  SMil_00008150-RA_Salv 268 DKQIVGTRSH 277
                            ****986554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.84E-1945109IPR009057Homeodomain-like
PROSITE profilePS5007117.44347107IPR001356Homeobox domain
SMARTSM003896.3E-1850111IPR001356Homeobox domain
PfamPF000465.3E-1652105IPR001356Homeobox domain
CDDcd000864.52E-1552108No hitNo description
Gene3DG3DSA:1.10.10.609.5E-2054114IPR009057Homeodomain-like
PRINTSPR000311.4E-57887IPR000047Helix-turn-helix motif
PROSITE patternPS00027082105IPR017970Homeobox, conserved site
PRINTSPR000311.4E-587103IPR000047Helix-turn-helix motif
PfamPF021838.9E-16107148IPR003106Leucine zipper, homeobox-associated
SuperFamilySSF1019411.31E-35180274IPR003441NAC domain
PROSITE profilePS5100531.948184336IPR003441NAC domain
PfamPF023653.2E-15185270IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MKKLSNFDSL GGLMSICPNA TEEESNNPMY AREFQTMLEG LEEEESGHVS EKKRRLSVDQ  60
VKALEKNFEV ENKLEPERKV KLAQELGLQP RQVAVWFQNR RARWKTKQLE RDYSGLKASY  120
DGLKLNFERL QRDNESLLKE IRELKSKLNE TTRPSQGFHY MIFRITDYKE MEKVKVVKNG  180
VLRLPPGFRF HPTDEELVVQ YLKRKVLSCP VPASIIPEVD MCKSDPWDLP GDSEQERYFF  240
STKQVKYPNG NRSNRATVSG YWKATGLDKQ IVGTRSHQLP NSLRHLRLPL ALPSNACNSE  300
TAAATDAAEY APYPKLEPDD VAPVADTWSS APTHRPLLST AAKAHESAAV GPPTTNFRSF  360
ERTRCIVVSA TSVKRGCRTP SLLRKRGTAA PTLSMQRTNK NEEITACSKP KTEARNEKKW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-2818227213106Stress-induced transcription factor NAC1
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
199107RRARWKTKQ
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27182453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.12e-63homeobox protein 6