PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00007554-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family Dof
Protein Properties Length: 306aa    MW: 32464.7 Da    PI: 4.6909
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00007554-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.71.2e-3847105361
                 zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                            ++ +kcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s
  SMil_00007554-RA_Salv  47 HQVVKCPRCDSLNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKTKRS 105
                            5789****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-2946104IPR003851Zinc finger, Dof-type
PfamPF027013.1E-3348104IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.42250104IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105288IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MPENWVVLNL EQVKSSRMQD MHGIGEGSGG GGRFISVGDR RLRPLNHQVV KCPRCDSLNT  60
KFCYYNNYNL SQPRHFCKSC RRYWTKGGVL RNVPVGGGCR KTKRSKPKAN ASSAAEDDAP  120
PGETKSSAQS SSSESSSLTT AAAAAATAPP TSAEEGSVPI YTTSDSAVMY NFADASFSNV  180
NPLANPSLDH QPAFVNDRPS TAGQIFSAEG GSFTGLMTSS EELMMGLDIA TTSYGQEEPA  240
AEKASVGVGK ADDLKMEDIS NAAALGWGSG GDDGDQGLFD LTAGVDPAYW SQSDWTDNDQ  300
SLNYLP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0281329e-65AB028132.1 Oryza sativa Japonica Group mRNA for Dof zinc finger protein, complete cds, clone: OsDof-8.
GenBankAK0610009e-65AK061000.1 Oryza sativa Japonica Group cDNA clone:006-203-F09, full insert sequence.
GenBankAK1008929e-65AK100892.1 Oryza sativa Japonica Group cDNA clone:J023130J11, full insert sequence.
GenBankAK1013219e-65AK101321.1 Oryza sativa Japonica Group cDNA clone:J033034E07, full insert sequence.
GenBankAP0052849e-65AP005284.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:B1121A12.
GenBankAP0149589e-65AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126109e-65CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
GenBankGQ1835329e-65GQ183532.1 Oryza sativa Japonica Group Dof-type zinc finger protein 05 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011072952.12e-93dof zinc finger protein DOF5.4-like
TrEMBLA0A4D9AF691e-127A0A4D9AF69_SALSN; Uncharacterized protein
STRINGMigut.K01260.1.p1e-74(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.13e-40OBF binding protein 4