PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00007088-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family bZIP
Protein Properties Length: 369aa    MW: 41856.8 Da    PI: 7.4696
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00007088-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.21.1e-1082114133
                            XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLee 33 
                            ek+++ +rr+++NReAAr+sR+RKka++++Le+
  SMil_00007088-RA_Salv  82 EKPSQIQRRLAQNREAARKSRLRKKAYVQQLET 114
                            788999*************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.001582142IPR004827Basic-leucine zipper domain
PfamPF001701.5E-782115IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.75E-786120No hitNo description
Gene3DG3DSA:1.20.5.1701.2E-788128No hitNo description
PROSITE patternPS00036089104IPR004827Basic-leucine zipper domain
PfamPF141441.9E-26171245IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
LFRLVLYSKV VVRMTTPTTQ FAPSSRLGLY EPMHQMSMWE DTFDGEAGVC MMNEADSKTD  60
DKIEYTSDKS AEDSRASRSI SEKPSQIQRR LAQNREAARK SRLRKKAYVQ QLETSRLKLA  120
QLELELERAR QQGMLMAGAS AHMGLCGNVS SGIGVFEMEY RHWVEEQERK ISELKKVLQT  180
CIGEAELRVM VESVLSHYCN LFRIKRDAAR ADAFYLVSGM WRTSVERFFL WIGGFKPSEL  240
INVVMPQLQP LTDLQTADVD NLKHSCMQAE DALSQGMEKL QQTLAQSVTF LPPGAGNYCS  300
QTAFALENLE SLESFINQAD HLRQQTLQHM SRILTTRQAA NGLVAFGEYF QRLRTLSSLW  360
SARCPGEPA
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1. Could also bind to the Hex-motif (5'-TGACGTGG-3') another cis-acting element found in plant histone promoters.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012829825.10.0PREDICTED: transcription factor TGA4-like isoform X2
SwissprotQ391621e-137TGA4_ARATH; Transcription factor TGA4
TrEMBLA0A4D8ZUK40.0A0A4D8ZUK4_SALSN; Transcription factor TGA
STRINGMigut.C00214.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7802497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10030.21e-128TGACG motif-binding factor 4
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA
    Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana.
    Plant J., 2017. 92(2): p. 305-316
    [PMID:28771873]