PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00006437-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family ZF-HD
Protein Properties Length: 239aa    MW: 25975 Da    PI: 8.7097
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00006437-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer97.51e-303384558
            ZF-HD_dimer  5 rYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                            +keC+kNhAa++GghavDGCgE+mp ++   ++ +l CaACgCHRnFHRr+++
  SMil_00006437-RA_Salv 33 AFKECMKNHAANIGGHAVDGCGEYMPPSS--DDPISLICAACGCHRNFHRRDPA 84
                           69************************843..47******************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015661.6E-273482IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-173489IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.3273482IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.7E-253482IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.607.9E-26128190IPR009057Homeodomain-like
SuperFamilySSF466895.38E-15129188IPR009057Homeodomain-like
TIGRFAMsTIGR015653.4E-24132188IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MDRDLTPTKS GDETEVDTPP HTHIKSHRRP PPAFKECMKN HAANIGGHAV DGCGEYMPPS  60
SDDPISLICA ACGCHRNFHR RDPAAITPPF LDFRRPGHTQ TSSPSPPFHY GPHVLLALGT  120
AEPAAENLQL GKKRSRTKFS QEQKERMHSF SDKLGWKMHR SDEAAVAEFC RDAGVARGVL  180
KVWMHNNKGT TGARTGNVDV VGGRAMSING SGGDKETRKS DDDNGGRCRN GSGGTLHFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-181331901875ZF-HD homeobox family protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor.
UniProtTranscription factor involved in the up-regulation of several stress-inducible genes. Acts as a transcriptional activator by interacting with MED25 and NAC proteins. Involved in increased drought tolerance. {ECO:0000269|PubMed:16428600, ECO:0000269|PubMed:17233795}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by abscisic acid and by drought and salt stress. Not induced by cold. {ECO:0000269|PubMed:17233795}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070997.15e-76zinc-finger homeodomain protein 10
SwissprotQ9LXG09e-50ZHD8_ARATH; Zinc-finger homeodomain protein 8
SwissprotQ9SEZ18e-50ZHD11_ARATH; Zinc-finger homeodomain protein 11
TrEMBLA0A4D8YIB39e-71A0A4D8YIB3_SALSN; Uncharacterized protein
STRINGXP_009620302.12e-55(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10882485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69600.13e-52zinc finger homeodomain 1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]