PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00006434-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 327aa    MW: 37087.8 Da    PI: 7.2879
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00006434-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.44.8e-5251303128
                    NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                            pGfrFhPtdeelv +yL++k+ +++l++ e ik++diyk++PwdLpk ++++ekewyf+++rd+ky++++r+nr+t sg+Wkatg+d+
  SMil_00006434-RA_Salv   5 PGFRFHPTDEELVGFYLTRKILHRPLSI-ELIKQIDIYKYDPWDLPKLATNGEKEWYFYCPRDRKYRNSTRPNRVTGSGFWKATGTDR 91 
                            9***************************.89***************88888999********************************** PP

                    NAM  91 evlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                            +++s+ +++ +glkk+Lvfykg+a kg ktdW+mhe+rl
  SMil_00006434-RA_Salv  92 PIYSShTTKCIGLKKSLVFYKGKAAKGIKTDWMMHEFRL 130
                            ****856667***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100556.23153IPR003441NAC domain
SuperFamilySSF1019411.96E-594153IPR003441NAC domain
PfamPF023651.6E-255130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MEELPGFRFH PTDEELVGFY LTRKILHRPL SIELIKQIDI YKYDPWDLPK LATNGEKEWY  60
FYCPRDRKYR NSTRPNRVTG SGFWKATGTD RPIYSSHTTK CIGLKKSLVF YKGKAAKGIK  120
TDWMMHEFRL PSLSPSSTIP INESWAICRI FKKANSNTRR ALSLSHSWPN PILDTTESHI  180
INPLNNTPTM SSSLQFGFSN DFQHSSFSPP YFKPEDHAIS CIETTTPASR CHVVSDATSL  240
LLDMSTSILG GDFGADTAGL SASSFNGFLG TPEDLQRNLV EEAVNMGQVD EQWMEFPYGF  300
PPNLMWDSSS PYPSHLSTTY STNKCYT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-55515919171NO APICAL MERISTEM PROTEIN
1ut4_B3e-55515919171NO APICAL MERISTEM PROTEIN
1ut7_A3e-55515919171NO APICAL MERISTEM PROTEIN
1ut7_B3e-55515919171NO APICAL MERISTEM PROTEIN
3swm_A3e-55515922174NAC domain-containing protein 19
3swm_B3e-55515922174NAC domain-containing protein 19
3swm_C3e-55515922174NAC domain-containing protein 19
3swm_D3e-55515922174NAC domain-containing protein 19
3swp_A3e-55515922174NAC domain-containing protein 19
3swp_B3e-55515922174NAC domain-containing protein 19
3swp_C3e-55515922174NAC domain-containing protein 19
3swp_D3e-55515922174NAC domain-containing protein 19
4dul_A3e-55515919171NAC domain-containing protein 19
4dul_B3e-55515919171NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071000.11e-126putative NAC domain-containing protein 94
SwissprotQ9FIW52e-90NAC94_ARATH; Putative NAC domain-containing protein 94
TrEMBLA0A2G9I2U71e-121A0A2G9I2U7_9LAMI; Uncharacterized protein
STRINGVIT_01s0026g02360.t011e-122(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22022262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-90NAC family protein