PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00005728-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family Dof
Protein Properties Length: 273aa    MW: 29935.2 Da    PI: 8.4681
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00005728-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.58.3e-4045105262
                 zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                            ke+al+cprC+stntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rknk+ss
  SMil_00005728-RA_Salv  45 KEQALNCPRCNSTNTKFCYYNNYSLSQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSS 105
                            6899******************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-2747103IPR003851Zinc finger, Dof-type
PfamPF027017.2E-3447103IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.26449103IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105187IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009639Biological Processresponse to red or far red light
GO:0009845Biological Processseed germination
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MDTAQWPQGI GVAKPAIDNS NSNSSSKPSN GGAAAAAEKK PRPEKEQALN CPRCNSTNTK  60
FCYYNNYSLS QPRYFCKTCR RYWTEGGSLR NVPVGGGSRK NKRSSPAPPP LSAKKPLPDP  120
NFSPQNPKIQ EGHDLNLAYN PSHYNAMSEF VALHQTLGNP NSERHHHHNM PLMELLKTGG  180
GLSSFMSAPI SDAGFPSSSA GFPAQDFKPS LGFSVDGMDQ AFGNMQDQTN QPSRILFPFE  240
ELKPVSNHDQ FEQERVQGET NVYWNGMLAG GSW
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor specifically involved in the maternal control of seed germination. Regulates transcription by binding to a 5'-AA[AG]G-3' consensus core sequence. May ensure the inactivity of a component that would be activated to trigger germination as a consequence of red light perception.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011075948.12e-97dof zinc finger protein DOF4.6-like
SwissprotQ433854e-53DOF37_ARATH; Dof zinc finger protein DOF3.7
TrEMBLA0A4D8ZWA91e-142A0A4D8ZWA9_SALSN; Uncharacterized protein
STRINGVIT_16s0098g01420.t015e-91(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.31e-51Dof family protein