PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00005539-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 363aa    MW: 40694.4 Da    PI: 7.8256
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00005539-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.53.2e-50231482128
                    NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                            +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +ekewyf+++rd+ky++g+r+nr+t+sgyWkatg d
  SMil_00005539-RA_Salv  23 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPALAAIGEKEWYFYVPRDRKYRNGDRPNRVTTSGYWKATGAD 109
                            79***************************.89***************8778899********************************** PP

                    NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            + + s++ + +glkktLvfy+g+apkg +t+W+m+eyrl
  SMil_00005539-RA_Salv 110 RMIRSENLRSIGLKKTLVFYSGKAPKGIRTSWIMNEYRL 148
                            *************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-5622168IPR003441NAC domain
PROSITE profilePS5100555.91222169IPR003441NAC domain
PfamPF023653.3E-2524148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MAIAADMNNQ ESKQDEHEND VVMPGFRFHP TEEELVEFYL RRKVEGKRFN VELITFLDLY  60
RYDPWELPAL AAIGEKEWYF YVPRDRKYRN GDRPNRVTTS GYWKATGADR MIRSENLRSI  120
GLKKTLVFYS GKAPKGIRTS WIMNEYRLPH HDTERLQKAE ISLCRVYKRA GVEDHPSLPR  180
CLPTKATASS SRGSQQARKQ QETSTSSRGL IFQPSYGGSP QQTDGKLSET SPTSSADIGT  240
SLALSHGTSF SINPLAPIVA GEDGHLQQQP KTIFSTAASS SNAIDDLHKF VQNYSSSQQA  300
IGHESHHHYN PPNLVSHFAA LQPETQELGA VPASLPAAAA YSDRLWEWSG ISEAGKDYSN  360
LFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-552416919165NO APICAL MERISTEM PROTEIN
1ut4_B2e-552416919165NO APICAL MERISTEM PROTEIN
1ut7_A2e-552416919165NO APICAL MERISTEM PROTEIN
1ut7_B2e-552416919165NO APICAL MERISTEM PROTEIN
3swm_A3e-552416922168NAC domain-containing protein 19
3swm_B3e-552416922168NAC domain-containing protein 19
3swm_C3e-552416922168NAC domain-containing protein 19
3swm_D3e-552416922168NAC domain-containing protein 19
3swp_A3e-552416922168NAC domain-containing protein 19
3swp_B3e-552416922168NAC domain-containing protein 19
3swp_C3e-552416922168NAC domain-containing protein 19
3swp_D3e-552416922168NAC domain-containing protein 19
4dul_A2e-552416919165NAC domain-containing protein 19
4dul_B2e-552416919165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022897039.11e-176NAC domain-containing protein 35-like
SwissprotQ9ZVP81e-112NAC35_ARATH; NAC domain-containing protein 35
TrEMBLA0A2U5GF650.0A0A2U5GF65_SALMI; NAC transcription factor 5
STRINGcassava4.1_009166m1e-147(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38882446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.11e-114NAC domain containing protein 35
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Okajima K
    Molecular mechanism of phototropin light signaling.
    J. Plant Res., 2016. 129(2): p. 149-57
    [PMID:26815763]
  3. Nakasone Y,Ohshima M,Okajima K,Tokutomi S,Terazima M
    Photoreaction Dynamics of LOV1 and LOV2 of Phototropin from Chlamydomonas reinhardtii.
    J Phys Chem B, 2018. 122(6): p. 1801-1815
    [PMID:29355019]