PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00005206-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family bZIP
Protein Properties Length: 373aa    MW: 41972.6 Da    PI: 6.9589
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00005206-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.32.9e-1286117233
                            XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLee 33 
                            +++k+ rr+++NReAAr+sR+RKka++++Le 
  SMil_00005206-RA_Salv  86 PPDKVLRRLAQNREAARKSRLRKKAYVQQLES 117
                            5799**************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.0E-781128No hitNo description
SMARTSM003383.1E-585145IPR004827Basic-leucine zipper domain
PfamPF001702.4E-987117IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.64687129IPR004827Basic-leucine zipper domain
CDDcd147087.73E-2189141No hitNo description
SuperFamilySSF579598.13E-789125No hitNo description
PROSITE patternPS00036092107IPR004827Basic-leucine zipper domain
PfamPF141441.0E-26175251IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042742Biological Processdefense response to bacterium
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
LTCTQTLIQP TMMNSTSTQF VPSRRMGIYE PIHQMGMWGD FKGNNCLDAS PPMILEVDPK  60
LDNQSEDTSH GTVGPSNKYD QEASKPPDKV LRRLAQNREA ARKSRLRKKA YVQQLESSKL  120
RLIQLEQELG RARQQGLYSG SALDASPLGY AGSMNPGIAT FELEYGHWVE EQDRQLSDLR  180
NALHSSETGD VELRIFVDGG LAHYFDLFTM KAIAAKTDVF FLMSGMWKTS AERFFFWIGG  240
FRPSELLKVL LPHLEPLSEQ QRLDLGNLTQ SCQQAEDALS QGMERLHQIL GEAIAKQLGE  300
GNYLPQVGAA IEKLDDLVRF VGQADHLRQE TLQQISRILT TRQAARGLLA LGEYFQRLRA  360
LSSLWSSRPR QSS
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1. Could also bind to the Hex-motif (5'-TGACGTGG-3') another cis-acting element found in plant histone promoters.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00642SELEXTransfer from LOC107771743Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011097616.10.0TGACG-sequence-specific DNA-binding protein TGA-1A isoform X3
RefseqXP_020554278.10.0TGACG-sequence-specific DNA-binding protein TGA-1A isoform X1
SwissprotQ392371e-176TGA1_ARATH; Transcription factor TGA1
TrEMBLA0A4D8ZE640.0A0A4D8ZE64_SALSN; Transcription factor TGA
STRINGMigut.L00088.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7802497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65210.51e-159bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Herrera-Vásquez A, et al.
    Transcriptional Control of Glutaredoxin GRXC9 Expression by a Salicylic Acid-Dependent and NPR1-Independent Pathway in Arabidopsis.
    Plant Mol. Biol. Rep., 2018.
    [PMID:26696694]
  4. Gutsche N,Zachgo S
    The N-Terminus of the Floral Arabidopsis TGA Transcription Factor PERIANTHIA Mediates Redox-Sensitive DNA-Binding.
    PLoS ONE, 2016. 11(4): p. e0153810
    [PMID:27128442]
  5. Sun T, et al.
    TGACG-BINDING FACTOR 1 (TGA1) and TGA4 regulate salicylic acid and pipecolic acid biosynthesis by modulating the expression of SYSTEMIC ACQUIRED RESISTANCE DEFICIENT 1 (SARD1) and CALMODULIN-BINDING PROTEIN 60g (CBP60g).
    New Phytol., 2018. 217(1): p. 344-354
    [PMID:28898429]